KEGG   Acinonyx jubatus (cheetah): 106971075Help
Entry
106971075         CDS       T04657                                 

Gene name
LSP1
Definition
(RefSeq) lymphocyte-specific protein 1 isoform X1
  KO
K14957  lymphocyte-specific protein 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04625  C-type lectin receptor signaling pathway
aju05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106971075 (LSP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106971075 (LSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 106971075
NCBI-ProteinID: XP_026901213
LinkDB All DBs
Position
Unknown
AA seq 363 aa AA seqDB search
MAEAPSHPGSEEQEALLVDKDAGLTTQRSAEDEEEAARERRRRARDRELRAQDEDGGQSP
EPPERESLLSLKPSEAPELDEDEGFSDWSQKPEPQRQPWEAGGASNSGEPPRSESPEGQQ
EENRPHQHAYGSQGGDEQSPARVSLEELHLSPSSELQDGPGTEETEPKSPEGTVQGSLGP
AEAEEADEQHQKHQQPRTPSPLVLEGATAQGSPPLSPSTKLIDRTESLNRSIRKSNSVKK
SQPALPISKIDERLEQYTQAIETAGRTPKLTRQPSIELPSMAVASTKSRWETREVQAQST
AKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKQSTPSGKRYKFVATGHGKYEKVLVDEG
SVP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctccgagccaccctggctccgaggagcaggaggcgctactggtggacaaa
gacgccgggctcacgactcagcggagcgcggaagatgaggaggaggccgcccgcgagcgt
cgccgccgggcgagggacagggagcttcgggcccaggacgaggacggcggccagtccccc
gagccgccggagcgggagagcctcctcagcctgaagccctcagaggcccctgaactggat
gaggacgagggtttcagcgactggtcccagaagccagagccacagcggcagccctgggag
gccgggggggcctccaacagcggggagccccctcggagcgagagtccggaggggcagcag
gaggagaacaggccccatcagcatgcctacgggagtcagggtggtgatgagcagagtcca
gccagagtcagcctggaggagttgcatctgagccccagctcagagctccaggacgggccg
ggaacagaggagacagagcccaagagcccagaggggaccgtccagggcagcctggggccg
gcagaagccgaagaggcagacgagcagcaccagaaacaccagcagcccaggacgcccagc
cccctggtcttggagggtgctaccgcacagggctcacctcccctgagccccagcaccaaa
ctcatcgacagaaccgagtccctgaaccgctccatcaggaagagtaacagtgtgaagaag
tcccaaccagccttgcccatctccaagattgatgagcgactggagcagtacacacaggcc
attgagactgctggccggacccccaagctaacccgccagccctccattgagctgcccagc
atggctgtggcgagcaccaagagccggtgggagacaagagaagttcaggctcagtccact
gccaagaccccctcttgcaaggatatcgtagctggagacatgagcaagaaaagcctctgg
gagcaaaaaggaggctccaagacatcatcgacaattaagcagagcactccgtctggaaag
aggtacaagtttgtggccaccggacatgggaagtatgagaaggtgcttgtggacgagggc
tcggtgccctag

DBGET integrated database retrieval system