KEGG   Acinonyx jubatus (cheetah): 106971136
Entry
106971136         CDS       T04657                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01523  Antifolate resistance
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04024  cAMP signaling pathway
aju04062  Chemokine signaling pathway
aju04064  NF-kappa B signaling pathway
aju04066  HIF-1 signaling pathway
aju04071  Sphingolipid signaling pathway
aju04137  Mitophagy - animal
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04211  Longevity regulating pathway
aju04218  Cellular senescence
aju04380  Osteoclast differentiation
aju04620  Toll-like receptor signaling pathway
aju04621  NOD-like receptor signaling pathway
aju04622  RIG-I-like receptor signaling pathway
aju04623  Cytosolic DNA-sensing pathway
aju04625  C-type lectin receptor signaling pathway
aju04657  IL-17 signaling pathway
aju04658  Th1 and Th2 cell differentiation
aju04659  Th17 cell differentiation
aju04660  T cell receptor signaling pathway
aju04662  B cell receptor signaling pathway
aju04668  TNF signaling pathway
aju04722  Neurotrophin signaling pathway
aju04917  Prolactin signaling pathway
aju04920  Adipocytokine signaling pathway
aju04926  Relaxin signaling pathway
aju04931  Insulin resistance
aju04932  Non-alcoholic fatty liver disease
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05030  Cocaine addiction
aju05132  Salmonella infection
aju05133  Pertussis
aju05134  Legionellosis
aju05135  Yersinia infection
aju05140  Leishmaniasis
aju05142  Chagas disease
aju05145  Toxoplasmosis
aju05146  Amoebiasis
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05203  Viral carcinogenesis
aju05212  Pancreatic cancer
aju05215  Prostate cancer
aju05220  Chronic myeloid leukemia
aju05221  Acute myeloid leukemia
aju05222  Small cell lung cancer
aju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aju05321  Inflammatory bowel disease
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106971136 (RELA)
   04014 Ras signaling pathway
    106971136 (RELA)
   04064 NF-kappa B signaling pathway
    106971136 (RELA)
   04668 TNF signaling pathway
    106971136 (RELA)
   04066 HIF-1 signaling pathway
    106971136 (RELA)
   04071 Sphingolipid signaling pathway
    106971136 (RELA)
   04024 cAMP signaling pathway
    106971136 (RELA)
   04151 PI3K-Akt signaling pathway
    106971136 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106971136 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    106971136 (RELA)
   04218 Cellular senescence
    106971136 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106971136 (RELA)
   04621 NOD-like receptor signaling pathway
    106971136 (RELA)
   04622 RIG-I-like receptor signaling pathway
    106971136 (RELA)
   04623 Cytosolic DNA-sensing pathway
    106971136 (RELA)
   04625 C-type lectin receptor signaling pathway
    106971136 (RELA)
   04660 T cell receptor signaling pathway
    106971136 (RELA)
   04658 Th1 and Th2 cell differentiation
    106971136 (RELA)
   04659 Th17 cell differentiation
    106971136 (RELA)
   04657 IL-17 signaling pathway
    106971136 (RELA)
   04662 B cell receptor signaling pathway
    106971136 (RELA)
   04062 Chemokine signaling pathway
    106971136 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106971136 (RELA)
   04917 Prolactin signaling pathway
    106971136 (RELA)
   04926 Relaxin signaling pathway
    106971136 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    106971136 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106971136 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    106971136 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106971136 (RELA)
   05202 Transcriptional misregulation in cancer
    106971136 (RELA)
   05203 Viral carcinogenesis
    106971136 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106971136 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    106971136 (RELA)
   05221 Acute myeloid leukemia
    106971136 (RELA)
   05220 Chronic myeloid leukemia
    106971136 (RELA)
   05215 Prostate cancer
    106971136 (RELA)
   05222 Small cell lung cancer
    106971136 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    106971136 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106971136 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    106971136 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106971136 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106971136 (RELA)
   04931 Insulin resistance
    106971136 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    106971136 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106971136 (RELA)
   05135 Yersinia infection
    106971136 (RELA)
   05133 Pertussis
    106971136 (RELA)
   05134 Legionellosis
    106971136 (RELA)
   05152 Tuberculosis
    106971136 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106971136 (RELA)
   05170 Human immunodeficiency virus 1 infection
    106971136 (RELA)
   05162 Measles
    106971136 (RELA)
   05164 Influenza A
    106971136 (RELA)
   05161 Hepatitis B
    106971136 (RELA)
   05160 Hepatitis C
    106971136 (RELA)
   05168 Herpes simplex virus 1 infection
    106971136 (RELA)
   05163 Human cytomegalovirus infection
    106971136 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106971136 (RELA)
   05169 Epstein-Barr virus infection
    106971136 (RELA)
   05165 Human papillomavirus infection
    106971136 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106971136 (RELA)
   05145 Toxoplasmosis
    106971136 (RELA)
   05140 Leishmaniasis
    106971136 (RELA)
   05142 Chagas disease
    106971136 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    106971136 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106971136 (RELA)
Transcription factors [BR:aju03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    106971136 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 106971136
NCBI-ProteinID: XP_026900925
UniProt: A0A6J1Y992
LinkDB
Position
Unknown
AA seq 555 aa
MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPAPILAPGL
AQAVVPPAPKTTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ
LLNQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS
IADMDFSALLSQISS
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt
cgctccgcgggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac
ccccctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat
gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc
ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcgactctgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg
catcccatctttgacaaccgtgcccccaacaccgcggagctcaagatctgccgagtgaac
cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct
caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc
agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcagctgcc
gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc
gaggagttctcccccatggtcttcccttccgggcagatcccaagccagacccctgccttg
gcaccagcccctgccccaatcctggccccggcccctgcctctgtcccggcccctgcccct
gtccctgcccctgccccggccccagccccggcccctgccccaatcttagccccaggcctt
gctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg
gaggccctgctgcacctgcagtttgacgctgatgaagacctgggggccctgcttggcaac
agcgccgacccagcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag
ctgctgaaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaatac
cctgaggcaataactcgcctggtgacggggtcccagaggccccctgacccagctcccgct
cccctgggggcctctgggcttcccaacggcctcctctcaggggatgaagacttctcttcc
attgccgacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system