KEGG   Acinonyx jubatus (cheetah): 106971167
Entry
106971167         CDS       T04657                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01522  Endocrine resistance
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04152  AMPK signaling pathway
aju04218  Cellular senescence
aju04310  Wnt signaling pathway
aju04340  Hedgehog signaling pathway
aju04371  Apelin signaling pathway
aju04390  Hippo signaling pathway
aju04510  Focal adhesion
aju04530  Tight junction
aju04630  JAK-STAT signaling pathway
aju04917  Prolactin signaling pathway
aju04919  Thyroid hormone signaling pathway
aju04921  Oxytocin signaling pathway
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju04934  Cushing syndrome
aju05160  Hepatitis C
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05218  Melanoma
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
aju05221  Acute myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106971167 (CCND1)
   04340 Hedgehog signaling pathway
    106971167 (CCND1)
   04390 Hippo signaling pathway
    106971167 (CCND1)
   04371 Apelin signaling pathway
    106971167 (CCND1)
   04630 JAK-STAT signaling pathway
    106971167 (CCND1)
   04068 FoxO signaling pathway
    106971167 (CCND1)
   04151 PI3K-Akt signaling pathway
    106971167 (CCND1)
   04152 AMPK signaling pathway
    106971167 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106971167 (CCND1)
   04115 p53 signaling pathway
    106971167 (CCND1)
   04218 Cellular senescence
    106971167 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106971167 (CCND1)
   04530 Tight junction
    106971167 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    106971167 (CCND1)
   04921 Oxytocin signaling pathway
    106971167 (CCND1)
   04919 Thyroid hormone signaling pathway
    106971167 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106971167 (CCND1)
   05206 MicroRNAs in cancer
    106971167 (CCND1)
   05205 Proteoglycans in cancer
    106971167 (CCND1)
   05203 Viral carcinogenesis
    106971167 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106971167 (CCND1)
   05212 Pancreatic cancer
    106971167 (CCND1)
   05225 Hepatocellular carcinoma
    106971167 (CCND1)
   05226 Gastric cancer
    106971167 (CCND1)
   05214 Glioma
    106971167 (CCND1)
   05216 Thyroid cancer
    106971167 (CCND1)
   05221 Acute myeloid leukemia
    106971167 (CCND1)
   05220 Chronic myeloid leukemia
    106971167 (CCND1)
   05218 Melanoma
    106971167 (CCND1)
   05219 Bladder cancer
    106971167 (CCND1)
   05215 Prostate cancer
    106971167 (CCND1)
   05213 Endometrial cancer
    106971167 (CCND1)
   05224 Breast cancer
    106971167 (CCND1)
   05222 Small cell lung cancer
    106971167 (CCND1)
   05223 Non-small cell lung cancer
    106971167 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106971167 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106971167 (CCND1)
   04934 Cushing syndrome
    106971167 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106971167 (CCND1)
   05162 Measles
    106971167 (CCND1)
   05160 Hepatitis C
    106971167 (CCND1)
   05163 Human cytomegalovirus infection
    106971167 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106971167 (CCND1)
   05169 Epstein-Barr virus infection
    106971167 (CCND1)
   05165 Human papillomavirus infection
    106971167 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106971167 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 106971167
NCBI-ProteinID: XP_026901480
UniProt: A0A6J1YAW7
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELVLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVLAAVQGLPLGSSNSVLSCPRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccaactcttatgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgtgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctccaagatgaaggagaccattcccctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagctggtcctggtgaacaagctcaagtggaacctggccgcgatgaccccgcacgatttc
atcgagcacttcctctccaaaatgcccgtggccgaggagaacaaacagatcatccggaag
cacgcgcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaacccgcct
tccatggtggcagcggggagcgtgctggccgcggtgcaaggcctgcccctggggagctcc
aacagcgtcctgtcctgtccgcgcctcacccggttcctctccaaagtgatcaagtgtgac
gcggactgtctccgggcgtgccaggagcaaatcgaggccctgctggagtccagcctgcgc
caggcccagcagcagagcctagaccccaaggcggcggaggaggaggaggaggaggaggag
gccgacctggcctgcacacccaccgacgttcgagacgtgaacatttga

DBGET integrated database retrieval system