KEGG   Acinonyx jubatus (cheetah): 106971906
Entry
106971906         CDS       T04657                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju01522  Endocrine resistance
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04066  HIF-1 signaling pathway
aju04068  FoxO signaling pathway
aju04114  Oocyte meiosis
aju04115  p53 signaling pathway
aju04150  mTOR signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04152  AMPK signaling pathway
aju04211  Longevity regulating pathway
aju04213  Longevity regulating pathway - multiple species
aju04510  Focal adhesion
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04730  Long-term depression
aju04750  Inflammatory mediator regulation of TRP channels
aju04913  Ovarian steroidogenesis
aju04914  Progesterone-mediated oocyte maturation
aju04935  Growth hormone synthesis, secretion and action
aju04960  Aldosterone-regulated sodium reabsorption
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05205  Proteoglycans in cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05218  Melanoma
aju05224  Breast cancer
aju05410  Hypertrophic cardiomyopathy
aju05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106971906 (IGF1)
   04014 Ras signaling pathway
    106971906 (IGF1)
   04015 Rap1 signaling pathway
    106971906 (IGF1)
   04066 HIF-1 signaling pathway
    106971906 (IGF1)
   04068 FoxO signaling pathway
    106971906 (IGF1)
   04151 PI3K-Akt signaling pathway
    106971906 (IGF1)
   04152 AMPK signaling pathway
    106971906 (IGF1)
   04150 mTOR signaling pathway
    106971906 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106971906 (IGF1)
   04115 p53 signaling pathway
    106971906 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106971906 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    106971906 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    106971906 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    106971906 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    106971906 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    106971906 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    106971906 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    106971906 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    106971906 (IGF1)
   04213 Longevity regulating pathway - multiple species
    106971906 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106971906 (IGF1)
   05202 Transcriptional misregulation in cancer
    106971906 (IGF1)
   05205 Proteoglycans in cancer
    106971906 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    106971906 (IGF1)
   05218 Melanoma
    106971906 (IGF1)
   05215 Prostate cancer
    106971906 (IGF1)
   05224 Breast cancer
    106971906 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    106971906 (IGF1)
   05414 Dilated cardiomyopathy
    106971906 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106971906 (IGF1)
   01522 Endocrine resistance
    106971906 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aju04052]
    106971906 (IGF1)
Cytokines and growth factors [BR:aju04052]
 Growth factors
  Growth factors (RTK binding)
   106971906 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 106971906
NCBI-ProteinID: XP_026926783
UniProt: A0A6J2ABA2
LinkDB
Position
Unknown
AA seq 171 aa
MVTPTVKMHIMSPSHLFYLGLCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKP
TGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKYH
PPSTTKKTKSQRRRKGGPKKHPGGEQKVGTEASQQMKGKKKEQRRETGARN
NT seq 516 nt   +upstreamnt  +downstreamnt
atggttacacctacagtaaagatgcacatcatgtccccctctcatctcttctatctgggc
ctgtgcttgctcaccttcaccagctccgccacagctggaccagagactctctgtggggct
gagttggtggacgctcttcagttcgtgtgtggagacaggggtttttatttcaacaagccc
acggggtatggctccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgc
ttccggagctgtgatctgaggcggctagagatgtactgtgcacccctcaagcctgccaag
tctgcccgctcagtccgtgctcagcgccacactgacatgcccaaggctcagaagtatcat
cccccatctaccaccaagaaaacgaagtctcagaggagaaggaaaggtgggccaaagaaa
cacccaggaggggagcagaaggtggggacagaagcaagtcagcagatgaaaggaaagaag
aaagagcagagaagggagactggagctagaaactga

DBGET integrated database retrieval system