Acinonyx jubatus (cheetah): 106972372 Help Entry 106972372         CDS       T04657                                  Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04810   Regulation of actin cytoskeleton aju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aju00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106972372  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106972372 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 SPX Matrilin_ccoil LXG DUF5617 Motif Other DBs NCBI-GeneID:  106972372 NCBI-ProteinID:  XP_014924837 UniProt:  A0A6I9ZKT1 LinkDB All DBs Position A2:complement(115246087..115254778) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcggactttctcaactcgttcgat atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagccctcgaacggaga atagagtacattgaagcacgggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system