KEGG   Acinonyx jubatus (cheetah): 106972406
Entry
106972406         CDS       T04657                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04015  Rap1 signaling pathway
aju04371  Apelin signaling pathway
aju04390  Hippo signaling pathway
aju04514  Cell adhesion molecules
aju04520  Adherens junction
aju05100  Bacterial invasion of epithelial cells
aju05200  Pathways in cancer
aju05213  Endometrial cancer
aju05216  Thyroid cancer
aju05218  Melanoma
aju05219  Bladder cancer
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    106972406 (CDH1)
   04390 Hippo signaling pathway
    106972406 (CDH1)
   04371 Apelin signaling pathway
    106972406 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    106972406 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106972406 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106972406 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    106972406 (CDH1)
   05216 Thyroid cancer
    106972406 (CDH1)
   05218 Melanoma
    106972406 (CDH1)
   05219 Bladder cancer
    106972406 (CDH1)
   05213 Endometrial cancer
    106972406 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    106972406 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106972406 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:aju04515]
    106972406 (CDH1)
   04090 CD molecules [BR:aju04090]
    106972406 (CDH1)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106972406 (CDH1)
Cell adhesion molecules [BR:aju04515]
 Cadherins
  Major cadherins
   106972406 (CDH1)
CD molecules [BR:aju04090]
 Proteins
  106972406 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Big_9
Other DBs
NCBI-GeneID: 106972406
NCBI-ProteinID: XP_014924878
UniProt: A0A6I9ZQE1
LinkDB
Position
Unknown
AA seq 881 aa
MGPPSRSVSALLLLLQVTSGLCQEPEPCRPGFGADSYTFTVPRRHLERGRVLGRVSFEGC
TGQPRTAYFSDDTRIKVGSDGVVSVRRPLQLHKPEMSFLVHAWDSSRRKLSTKVTLKAAV
RHHHRHHDTLSETQTEVLTFPNSQHGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNR
DKEIKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDREQIAKYILYSHAVSSNGHAV
EDPMEIVITVTDQNDNKPEFTQQVFEGSVMESALPGTSVMQVTATDADDDENTYNAAIAY
TILSQEPPLPQSTMFTINRDTGVISVVTTGLDRESVPMYTLVVQAADLQGEGLSTTATAV
ITVTDINDNPPIFEPTTYQGQVPENEANVEITVLKVTDADVPNTPAWQAVYTILNNKDDQ
FVVTTDPVTNDGILKTAKGLDFETKRQYILYVAVENVSPFEVILSTSTATVTVDVEDVNE
APIFVPLQKEVHIPEDFGVGLEITSYTAEDPDQFMEQRITYRIWRDAANWLRIDPDTGAI
FTRAELDREDFEHVKNSTYTALIIATDNGSPLATGTGTLLLILSDVNDNGPVPEPRSMDF
CQKNPQPHIINIFDPDLPPNTSPFTAELTHGASVNWTIDYSDQARESLILKPKKTLELGD
YKINLKLVDNQNKDQVTTLDVYVCDCEGVVNNCKRTMPYAEAGLQVPAILGILGGILALL
ILILLLLLFVRRRGVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPE
VTRNDVAPTLLSMPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSE
AASLSSLNSSESDRDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgggccctccgtcgcgtagcgtctccgcgctcctgctgctgctacaggtcacatcaggg
ctctgccaggagcccgagccctgccgtcctggctttggcgccgacagctacacgttcacc
gtgccccgtcgacatttggagagaggccgagtcctgggcagagtgagttttgaaggatgc
accggtcaaccaaggacagcctatttttctgatgacacgcgaatcaaagtgggcagcgat
ggtgtggttagcgtcagacggcctctgcagcttcataaaccagagatgagttttctcgtc
cacgcctgggactccagccgcaggaagctgtccaccaaagttacgctgaaggcagcagtg
cgccatcaccaccgccatcacgacactctctccgaaacccagacagaagtgctcacattt
cccaactcccagcatggtcttagaagacagaagagagactgggttatccctcctatcagc
tgcccagaaaatgagaaaggcccatttcctaaaaatctggttcagatcaaatctaacagg
gacaaagaaatcaaggttttctacagcatcactggccaaggggctgacacacctcctgtt
ggtgtgtttattattgaaagagaaacaggatggctgaaggtgacggagcctctggataga
gaacaaattgccaagtacattctgtactctcatgctgtgtcttcaaatgggcatgcagtc
gaagacccaatggagattgtgattacggtgacagatcagaatgacaacaagcccgagttc
acccagcaggtctttgaaggttctgtcatggaaagtgctcttccaggaacttctgtgatg
caggtcacggccacagatgcagatgacgacgagaatacctacaatgccgccatcgcatac
accatcctctcccaagagcccccgctgcctcagagcacaatgttcaccatcaatagggac
acaggagtcatcagtgtggtcaccaccgggctggaccgggagagtgtccccatgtacact
ctggtggttcaggctgctgacctgcaaggcgaaggtttaagtacaaccgcaacagccgtg
atcacggtcactgacatcaacgataaccctcccatctttgaaccaaccacgtaccagggg
caggtgcctgagaacgaagctaatgtcgaaatcaccgtactcaaagtgactgacgccgat
gtcccaaataccccagcgtggcaggccgtgtacaccatattgaacaataaggatgaccaa
tttgtcgtcaccacagacccagtaaccaatgatggcattttgaaaacagctaagggcttg
gattttgagaccaagcgacaatacattctgtatgtggccgtggagaatgtgtccccgttt
gaggttattctctccacctccacagccacagtcaccgtggacgtggaggatgtgaacgaa
gcccccatctttgtgcctctccaaaaggaagtgcacatacctgaagactttggtgtgggc
ctggaaatcacgtcctacactgctgaggatccggaccagtttatggaacagaggataacg
tatcggatttggagggatgctgccaactggctgaggattgatccagacactggtgccatt
ttcactcgggctgaattagacagagaggactttgagcatgtgaagaacagcacgtacacg
gccctcattatcgccaccgacaatggttctccacttgctactggaacgggaacccttctc
ctgatcctctctgatgtgaatgacaatggccccgtaccagaacctcgaagtatggatttc
tgccagaaaaatccacagcctcatatcatcaacatctttgatccagatcttccccccaac
acatctcccttcacggcagaactaacgcacggggcaagtgtcaactggaccattgactac
agtgaccaagcccgtgaatctctaattttgaagccaaagaaaaccttagagttgggcgac
tacaagataaatctcaaacttgtggataaccagaacaaggaccaggtgaccaccctagat
gtgtacgtttgtgactgcgaaggggtcgtcaacaactgcaagaggaccatgccttacgct
gaagcggggttgcaagttcctgccattctgggcattctcggaggaatcctcgccttacta
atcctgattctgctgcttttgctgtttgttcggaggagaggggtggtcaaagagccctta
ctacccccagaagatgacaccagggacaatgtttattactatgatgaagaaggaggtgga
gaagaggatcaggactttgacttgagccagttgcacaggggcctggatgctcggcctgaa
gtgactcgcaatgatgtggcaccaaccctcctgagcatgccccagtaccggccccgccct
gccaatcctgatgaaattggaaactttattgatgaaaacctgaaggcagcagacagtgac
cccactgctcctccttacgactctctgcttgtgtttgactatgaaggaagcggttctgaa
gctgctagtctgagctccttaaactcctcggaatcagaccgagatcaggactatgactac
ctgaatgaatggggcaatcgcttcaagaagctggcagacatgtacggaggtggtgaggat
gactag

DBGET integrated database retrieval system