KEGG   Acinonyx jubatus (cheetah): 106972415
Entry
106972415         CDS       T04657                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04330  Notch signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106972415 (DVL2)
   04330 Notch signaling pathway
    106972415 (DVL2)
   04390 Hippo signaling pathway
    106972415 (DVL2)
   04150 mTOR signaling pathway
    106972415 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106972415 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106972415 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106972415 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106972415 (DVL2)
   05226 Gastric cancer
    106972415 (DVL2)
   05217 Basal cell carcinoma
    106972415 (DVL2)
   05224 Breast cancer
    106972415 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106972415 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    106972415 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106972415 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106972415 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 106972415
NCBI-ProteinID: XP_026903295
UniProt: A0A6J1YG46
LinkDB
Position
Unknown
AA seq 735 aa
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDSARLPCFNGRVVSWLVSSDNPQPEVAPPAHEPRTELAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDDDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERASSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTMTSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDDGSSGASDQDTLAPLPG
ATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGA
GRTGRPEERAPESKSGSGSESEPSTRGGSLRRGGDPGGAGDGGPPPSRGSSGGAPNLRAH
PGLHPYGPPPGMALPYNPMMVVMVPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSF
HMAMGNPSEFFVDVM
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggcgggcagcggcgcggggggcggtggtgtcggggagacgaaggtgatttaccacctg
gatgaagaagagaccccgtacctggtgaagattcccgtccccgcggagcgcatcaccctg
ggcgatttcaagagcgtcctgcagcggcccgcgggcgctaagtactttttcaagtcaatg
gatcaggatttcggggtggtgaaggaggagatttcagatgacagcgcccgcctcccctgc
ttcaacggaagggtggtgtcctggctggtgtcatcggataacccccaacccgaggtggct
cccccagcccacgagcctcggaccgagctggcgccaccgccgccaccgttaccccctttg
ccgccggagaggaccagtggcattggcgactccagacctccatccttccaccctaacgtg
tccagcagccgggaaaacctggagcccgagacagaaacagagtcggtggtgtctctgcgg
cgggaacggcctcgcaggagagacagcagtgagcatggcgcggggggccacaggcctggc
ggcccctcgaggctggagcgccacctggccgggtacgagagctcctcgacgctcatgacc
agcgagctggagagcaccagcctgggcgactctgatgacgacgacaccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctcctgaagcgccaccggcggcggagg
aagcagcggccgccccgcctggagagggcctcgtccttcagcagcgtcaccgactccacc
atgtccctcaacatcatcacggtcacgctcaacatggagaagtacaacttcctgggcatc
tccatcgtgggccagagcaacgagcggggcgacggcggcatctacatcggctccatcatg
aaggggggcgccgtggcggccgacgggcgcatcgagccgggcgacatgttgctgcaggtg
aacgacgtgaacttcgagaacatgagcaatgacgacgcggtgcgggtgctgcgggacatc
gtgcacaagccgggccccatcgtgctgacggtggccaagtgctgggatccctctccccag
gcctacttcacccttcctcggaacgagcccatccagcccattgaccccgctgcctgggtg
tcccactccgccgcgctgacgggcaccttcccagcctatccgggttcctcgtccatgagc
accatgacatcggggtcctctctgcctgacggttgtgaggggcggggtctctccatccac
acagacatggcgtctgtgaccaaggccatggcagctcccgaatctggactggaagttcgg
gaccgcatgtggctcaagatcaccatccctaacgccttcctgggctcggacgtagttgac
tggctttaccatcacgtggaaggctttcctgagcgccgggaggcccgcaaatacgccagc
gggctgctcaaggctggcctcatccgacacacggtgaacaaaatcaccttctctgagcag
tgctattacgtgttcggggacctcagtggcggctgtgagagctacctggtcaacctgtcc
ctgaacgatgacggttccagcggggcttcggaccaggacaccttggccccgctgcctggg
gcgaccccgtggcccctcctgcccaccttctcctaccagtacccggccccgcacccatac
agcccccagccgccaccctaccatgagctctcatcctacacctacggcgggggcagtgcc
agcagccagcacagcgaggggagccggagcagtgggtcaacacggagcgatgggggggcg
gggcgtacggggaggcctgaggaacgggcccccgagtccaagtccggcagcggcagtgag
tctgagccctccacccgggggggcagccttcggcgggggggggaccctggtggggctggt
gatgggggcccacccccttccagaggctcttcggggggcgcgcccaatctccgagcccac
cccgggctgcatccgtacggaccaccccctggcatggccctcccctacaatcccatgatg
gtggtcatggtgcccccgcccccgccccccgtgcctccagcagtgcagcccccgggggcc
cctccggtcagagacctgggctctgtgcccccggagctgaccgccagccgccagagcttc
cacatggccatgggcaaccccagtgagttctttgtggatgtcatgtag

KEGG   Acinonyx jubatus (cheetah): 106983787
Entry
106983787         CDS       T04657                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04330  Notch signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106983787 (DVL3)
   04330 Notch signaling pathway
    106983787 (DVL3)
   04390 Hippo signaling pathway
    106983787 (DVL3)
   04150 mTOR signaling pathway
    106983787 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106983787 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106983787 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106983787 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106983787 (DVL3)
   05226 Gastric cancer
    106983787 (DVL3)
   05217 Basal cell carcinoma
    106983787 (DVL3)
   05224 Breast cancer
    106983787 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106983787 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    106983787 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106983787 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106983787 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 106983787
NCBI-ProteinID: XP_026917125
UniProt: A0A6J1ZLK2
LinkDB
Position
Unknown
AA seq 718 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSMASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPTKNFGLFDFL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggaaatc
tctgacgacaatgccaagctgccctgcttcaatggccgcgtggtgtcctggttggtgtct
gctgagggctcacacccagagcctgctcccttctgtgctgacaacccatcggaactgcca
ccacccatggaacgcacaggaggcattggggactcccggcccccatccttccaccctcat
gctggtggaggcagccaggagaacttggacaatgacacagagacagactccttggtgtca
gcccagcgtgagcggccacgcaggagggacggcccagaacacacaacccggctaaatgga
actgcaaagggggagcggcggcgagagccagggggttacgatagctcatccacccttatg
agcagcgagttagagaccaccagcttctttgattcggatgaggatgactccaccagcagg
ttcagcagctccacagagcagagcagcgcctcacgcctgatgagaagacataagcggcgg
cggaggaagcagaaggtttcgcggattgagcggtcctcgtccttcagcagcatcacggac
tccaccatgtcactcaacatcatcacagtcactctcaacatggaaaagtacaactttttg
ggcatctccattgtgggccaaagcaacgagcgtggtgatggaggcatctacatcggctct
atcatgaagggtggggctgtggctgcagatggacgcatcgagccaggagatatgctgtta
caggtaaacgagatcaactttgagaacatgagtaatgacgacgcagtccgggtactgcgg
gagattgtgcacaaaccggggcccatcaccctgactgtagccaagtgctgggacccaagt
ccacgtggttgcttcacactgcccaggagcgagcccatccggcccattgaccctgccgcc
tgggtctcccacactgcagccatgaccggcaccttccctgcctatggcatgagcccctcc
ctgagcaccatcacctccaccagctcttccatcaccagctccatccctgatacagaacgc
ctagacgacttccacctatccatccacagtgacatggccgccatcgtaaaagccatggcc
tcccctgaatctgggctggaggtccgtgaccgcatgtggctcaagattaccatccccaac
gctttcatcggctcagatgtggtggactggctgtaccacaacgtggaaggcttcactgac
cggcgagaggcccgcaaatatgccagcaacctgctgaaagccggcttcatccgccacact
gtcaacaagatcaccttctccgagcagtgctactatatcttcggtgacctctgtggcaac
atggccaacctgtccctccatgatcacgatggctccagcggcgcctctgaccaggacacg
ctggcccctttgccacacccaggggcagccccttggcccatggctttcccttaccagtac
ccgccgcccccgcacccctacaaccctcacccaggcttcccagagctggggtacagctat
ggtgggggcagcgccagcagtcagcacagtgaaggcagccggagcagtggctccaaccgt
agcggcagtgaccgacggaaggagaaggacccgaaggcgggggactcaaagtctggcggc
agcggcagcgagtcggaccacacaacccgcagcagcctgcgggggccgcgggagcgggcg
cccagcgagcgctcaggtcctgccgccagcgagcatagccaccgcagccaccactcaatg
gccagcagcctgcgcagtcaccacacgcacccgagctacggcccccctggcgtgccccct
ctctacggtccccccatgctgatgatgccccctccgcccgctgccatggggcccccagga
gcccctccgggtcgcgacctggcctccgtgccccccgaactgacagccagcagacagtcc
ttccgcatggccatgggaaaccccaccaagaatttcgggctgtttgactttctgtga

KEGG   Acinonyx jubatus (cheetah): 106988759
Entry
106988759         CDS       T04657                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04150  mTOR signaling pathway
aju04310  Wnt signaling pathway
aju04330  Notch signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106988759 (DVL1)
   04330 Notch signaling pathway
    106988759 (DVL1)
   04390 Hippo signaling pathway
    106988759 (DVL1)
   04150 mTOR signaling pathway
    106988759 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106988759 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106988759 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106988759 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106988759 (DVL1)
   05226 Gastric cancer
    106988759 (DVL1)
   05217 Basal cell carcinoma
    106988759 (DVL1)
   05224 Breast cancer
    106988759 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106988759 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    106988759 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106988759 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106988759 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 106988759
NCBI-ProteinID: XP_026916545
UniProt: A0A6J1ZJU8
LinkDB
Position
Unknown
AA seq 700 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQSTDGHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDCMDNDTGTESMVSHRRERARRRNREEAARTNGHPRGDRRRELGLPADSAST
VLSSELESSSFIDSDEDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDINFESMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVR
VMKLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKRGFL
RHTVNKITFSEQCYYVFGDLCSNLAALNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSAGGSSRRALGREKERRAAG
AGGSGSESDHAAPSGVAGSGWRERPASQLSRGSSPHSQASAAAPGLPPLYPLTKAYSAVG
GPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctatcacatggatgaggaggagacgccgtacctggtcaag
ctgcccgtggcgcccgagcgcgtcactctggccgacttcaagaatgtgctcagcaaccgg
cccgtgcacgcttacaaattcttcttcaagtccatggaccaggacttcggggtggtaaag
gaggagatctctgatgataacgccaagctgccctgcttcaacggccgcgtggtctcttgg
ctggtcctggctgagggcgcgcactcagacgcagggtctcagagcactgatggccataca
gacctgcccccgcctcttgagaggacgggcggcattggggattcccggcccccttctttc
caccccaatgtagcgagcagccgtgattgcatggacaacgacactggcacggagtccatg
gtcagccaccggcgggagagagcccgacgccggaaccgtgaagaggctgcccggaccaat
gggcacccgaggggggaccggcggcgagagctggggctgcccgccgacagcgcgtccacc
gtgctgagcagtgagcttgagtccagtagtttcatcgactcagacgaggatgacaacaca
agccgactgagcagctccacggagcagagcacctcctcccggctcatccggaagcacaag
cgccggcggcggaagcagcgcctgcggcagacggaccgtgcctcttcctttagcagcatc
acggactctactatgtccctgaacatcatcaccgtcacgctcaacatggagaggcaccac
ttcctaggcatcagtatcgtggggcagagcaacgaccggggagacggcggcatctatatc
ggctccatcatgaagggcggggccgtggctgccgacggccgcattgagcccggggacatg
ctgttgcaggtgaatgacatcaatttcgagagcatgagcaacgatgacgctgtgcgggtg
ctgcgggagatcgtgtcccagacggggcccatcagcctcacggtggccaagtgctgggac
ccaaccccccggagctacttcaccatcccgagggctgacccggttcggcccatcgaccct
gccgcctggctgtcccacacggcggcgctgaccggagccctgccccgctatggtacgagc
ccctgctccagcgccgtcacgcgtaccagctcctcctcactaaccagctctgtgcccggt
gctccgcagctggaggaggcgccgctgacggtgaagagtgacatgggtgctgtggtgcgt
gtcatgaagctgccagactcgggcctggagatccgagaccgcatgtggctcaagatcacc
atcgccaatgccgtcatcggggcggacgtggtggactggctgtacacgcacgtggagggc
ttcaaggaacggcgcgaggcccgcaagtacgccagcagcatgctgaagcgtggcttcctg
cggcacacggtgaacaagatcaccttctcggagcagtgctactacgtcttcggggacctg
tgcagcaatctcgcagccctgaacctcaacagtggttccagtggggcctcggatcaggac
acgctggccccgctgccccatccagccgccccctggcccctgggtcagggctacccctac
cagtacccgggccccccgccctgcttcccacctgcataccaggaccctggcttcagctat
ggcagcggcagtgctgggagtcagcagagtgaaggaagcaaaagcagtgggtccacccgg
agcgccggcggcagcagccggcgggcactgggccgcgagaaggagcgccgggcggctgga
gccggaggcagtggcagcgagtcggaccatgcagcaccgagtggggtcgctggcagcggc
tggagggagcgtccggctagtcagctcagccggggcagcagcccacacagtcaggcctcg
gctgccgccccgggcctccccccactgtaccccctgacaaaggcatactcggcggtgggg
gggccgcctggggggccacctgtccgggagctggctgctgttcccccagagctgacgggc
agccgccagtccttccagaaggccatgggaaacccctgtgaattttttgttgacatcatg
tga

DBGET integrated database retrieval system