KEGG   Acinonyx jubatus (cheetah): 106972437
Entry
106972437         CDS       T04657                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01522  Endocrine resistance
aju01524  Platinum drug resistance
aju04010  MAPK signaling pathway
aju04071  Sphingolipid signaling pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04137  Mitophagy - animal
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04211  Longevity regulating pathway
aju04216  Ferroptosis
aju04218  Cellular senescence
aju04310  Wnt signaling pathway
aju04722  Neurotrophin signaling pathway
aju04919  Thyroid hormone signaling pathway
aju05012  Parkinson disease
aju05014  Amyotrophic lateral sclerosis
aju05016  Huntington disease
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05203  Viral carcinogenesis
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05218  Melanoma
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05230  Central carbon metabolism in cancer
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106972437 (TP53)
   04310 Wnt signaling pathway
    106972437 (TP53)
   04071 Sphingolipid signaling pathway
    106972437 (TP53)
   04151 PI3K-Akt signaling pathway
    106972437 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106972437 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    106972437 (TP53)
   04210 Apoptosis
    106972437 (TP53)
   04216 Ferroptosis
    106972437 (TP53)
   04115 p53 signaling pathway
    106972437 (TP53)
   04218 Cellular senescence
    106972437 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    106972437 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    106972437 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    106972437 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106972437 (TP53)
   05202 Transcriptional misregulation in cancer
    106972437 (TP53)
   05206 MicroRNAs in cancer
    106972437 (TP53)
   05205 Proteoglycans in cancer
    106972437 (TP53)
   05203 Viral carcinogenesis
    106972437 (TP53)
   05230 Central carbon metabolism in cancer
    106972437 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106972437 (TP53)
   05212 Pancreatic cancer
    106972437 (TP53)
   05225 Hepatocellular carcinoma
    106972437 (TP53)
   05226 Gastric cancer
    106972437 (TP53)
   05214 Glioma
    106972437 (TP53)
   05216 Thyroid cancer
    106972437 (TP53)
   05220 Chronic myeloid leukemia
    106972437 (TP53)
   05217 Basal cell carcinoma
    106972437 (TP53)
   05218 Melanoma
    106972437 (TP53)
   05219 Bladder cancer
    106972437 (TP53)
   05215 Prostate cancer
    106972437 (TP53)
   05213 Endometrial cancer
    106972437 (TP53)
   05224 Breast cancer
    106972437 (TP53)
   05222 Small cell lung cancer
    106972437 (TP53)
   05223 Non-small cell lung cancer
    106972437 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    106972437 (TP53)
   05014 Amyotrophic lateral sclerosis
    106972437 (TP53)
   05016 Huntington disease
    106972437 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106972437 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106972437 (TP53)
   05161 Hepatitis B
    106972437 (TP53)
   05160 Hepatitis C
    106972437 (TP53)
   05162 Measles
    106972437 (TP53)
   05168 Herpes simplex virus 1 infection
    106972437 (TP53)
   05163 Human cytomegalovirus infection
    106972437 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106972437 (TP53)
   05169 Epstein-Barr virus infection
    106972437 (TP53)
   05165 Human papillomavirus infection
    106972437 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106972437 (TP53)
   01522 Endocrine resistance
    106972437 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106972437 (TP53)
   03036 Chromosome and associated proteins [BR:aju03036]
    106972437 (TP53)
   03400 DNA repair and recombination proteins [BR:aju03400]
    106972437 (TP53)
Transcription factors [BR:aju03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    106972437 (TP53)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106972437 (TP53)
DNA repair and recombination proteins [BR:aju03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106972437 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind DEC-1_N
Other DBs
NCBI-GeneID: 106972437
NCBI-ProteinID: XP_026903333
UniProt: A0A6J1YF15
LinkDB
Position
Unknown
AA seq 386 aa
MQEPPLELTIEPPLSQETFSELWNLLPENNVLSSELSSAMNELPLSEDVANWLDEAPDDA
SGMSAVPAPAAPAPATPAPAISWPLSSFVPSQKTYPGAYGFHLGFLQSGTAKSVTCTYSP
PLNKLFCQLAKTCPVQLWVRSPPPPGTCVRAMAIYKKSEFMTEVVRRCPHHERCPDSSDG
LAPPQHLIRVEGNLHAKYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMN
RRPIITIITLEDSNGKLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRA
LPPSTSSTPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQSGKEPGGSRAHSS
HLKAKKGQSTSRHKKPMLKREGLDSD
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgcaggagccgccgttggaactcaccatcgagccccctctgagccaggagacattttcg
gaattgtggaacctacttcccgaaaacaatgttctgtcttccgagctgtcctcagcgatg
aatgagctgccgctctcggaagatgtcgcaaactggctggatgaagcaccagatgatgct
tccggaatgtcagcggttccggcaccagcagcccctgcgccagccacccctgcgccagcc
atctcctggcccctgtcatcctttgtcccttcgcagaagacctacccgggcgcctatggt
ttccatttagggttcctgcagtcggggacggccaagtcggttacttgcacgtactcccct
cccctcaacaagctgttttgccagctggcgaagacctgccccgtgcagctgtgggtccga
tcgccgcccccaccgggaacctgtgtccgcgccatggccatttataagaagtcagagttc
atgacagaggtcgtgaggcgctgtccccaccacgagcgctgccctgacagtagcgatggt
ctggcgcctccccagcatctcatccgagtggaaggaaacttgcatgccaagtacctggac
gacagaaacactttccgacatagcgtcgtggtgccctacgagccgcccgaggtcggctcc
gactgtaccaccatccactacaatttcatgtgtaacagttcctgcatggggggcatgaac
cggaggcccatcatcaccatcatcaccctggaagactccaatgggaagctgctgggacgg
aacagcttcgaggtacgagtttgtgcctgtcctgggagagaccggcgcaccgaggaggaa
aatttccgcaagaagggggagccttgccctgagccgccccctgggagcactaagcgagcg
ctgccccccagcaccagctctactcccccacaaaagaagaagccactggatggagaatat
ttcacccttcagatccgtgggcgtgaacgcttcgagatgttccgagagctgaatgaggcc
ttggagctgaaggatgcccagagtggaaaggagccaggcggaagcagggcccactccagc
cacctgaaggctaagaaggggcagtctacctcccgccataaaaagccaatgttgaagaga
gaggggctcgactcagactga

DBGET integrated database retrieval system