KEGG   Acinonyx jubatus (cheetah): 106972608
Entry
106972608         CDS       T04657                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju04062  Chemokine signaling pathway
aju04066  HIF-1 signaling pathway
aju04068  FoxO signaling pathway
aju04217  Necroptosis
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04630  JAK-STAT signaling pathway
aju04659  Th17 cell differentiation
aju04917  Prolactin signaling pathway
aju04920  Adipocytokine signaling pathway
aju04931  Insulin resistance
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju04935  Growth hormone synthesis, secretion and action
aju05145  Toxoplasmosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05212  Pancreatic cancer
aju05221  Acute myeloid leukemia
aju05223  Non-small cell lung cancer
aju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aju05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106972608 (STAT3)
   04066 HIF-1 signaling pathway
    106972608 (STAT3)
   04068 FoxO signaling pathway
    106972608 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106972608 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106972608 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    106972608 (STAT3)
   04062 Chemokine signaling pathway
    106972608 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106972608 (STAT3)
   04917 Prolactin signaling pathway
    106972608 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    106972608 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106972608 (STAT3)
   05206 MicroRNAs in cancer
    106972608 (STAT3)
   05205 Proteoglycans in cancer
    106972608 (STAT3)
   05203 Viral carcinogenesis
    106972608 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106972608 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    106972608 (STAT3)
   05221 Acute myeloid leukemia
    106972608 (STAT3)
   05223 Non-small cell lung cancer
    106972608 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    106972608 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    106972608 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    106972608 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    106972608 (STAT3)
   05161 Hepatitis B
    106972608 (STAT3)
   05160 Hepatitis C
    106972608 (STAT3)
   05163 Human cytomegalovirus infection
    106972608 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106972608 (STAT3)
   05169 Epstein-Barr virus infection
    106972608 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106972608 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106972608 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106972608 (STAT3)
Transcription factors [BR:aju03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106972608 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 106972608
NCBI-ProteinID: XP_026904717
UniProt: A0A6J1YJ01
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacacggtacctggagcagcttcatcag
ctgtacagtgacagcttcccaatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatatgcggccagcaaagaatcacatgctactttggtgtttcataatctc
ttgggtgagattgaccagcagtacagccgtttcctacaggaatcgaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcaggtatctggagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcccgcctgctccagactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacggccgccgtggtgacggagaag
cagcagatgctggagcagcacctgcaagatgttcggaagcgagtacaggacctagaacag
aaaatgaaagtggtagagaacctccaggatgactttgacttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtccgtgaccaggcagaagatg
cagcagctggaacagatgctcacggcgctggaccagatgcggcgcagcatcgtgagtgag
ttggcggggctgttgtcagccatggagtatgtgcagaagacgctcacggatgaagagctg
gctgactggaagaggcggcagcagattgcgtgcatcgggggcccgcccaacatctgtctc
gaccgcctagaaaactggataacctcgttagcggaatctcaacttcagacgcgccaacaa
attaagaaactggaggagttgcagcaaaaagtgtcctacaaaggggatcccattgtacag
caccggccaatgctggaggagaggattgtggagctgtttagaaacttaatgaaaagtgcc
tttgtggttgagcggcagccctgcatgccaatgcatcccgaccggccattggtcatcaag
actggcgtccagttcactaccaaagtcagattgctggtcaaattccctgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggatgttgcagctctcagagga
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtccaac
aacggcagcctctctgcagaattcaaacatctgaccctgagagagcaaagatgtggtaac
gggggccgagccaattgtgatgcctccctgattgtcaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccagggcctcaagattgaccttgagacccactccttgccg
gttgtggtgatctccaacatctgtcagatgccgaatgcctgggcatctatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccaattgggacc
tgggatcaagtggctgaggtgctgagctggcagttctcctccactacaaagcgaggcctg
agcatcgagcagttgacgacgctggcagagaagctcttaggacctggtgtgaactattca
ggatgtcagattacgtgggctaaattttgcaaagaaaacatggccggcaaaggcttctcc
ttctgggtctggctagacaatatcattgatcttgtgaaaaagtacatcctggctctttgg
aacgaagggtacataatgggttttatcagtaaggagcgggagcgggccatcttgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggtgtcacc
ttcacttgggtagagaaggacatcagcggcaagacccagatccagtccgtggaaccatat
accaagcagcagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgctaccaacatcctcgtgtctccgctggtttatctctacccggacattcctaaggag
gaggcgtttggaaagtattgtcgaccagaaagccaggagcatcctgaagctgacccaggt
agtgctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcagtttgaatccctcacgttcgacatggag
ttgacctcggagtgcgccacctccccaatgtga

DBGET integrated database retrieval system