KEGG   Acinonyx jubatus (cheetah): 106972615Help
Entry
106972615         CDS       T04657                                 

Gene name
EZH1
Definition
(RefSeq) histone-lysine N-methyltransferase EZH1 isoform X1
  KO
K17451  histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106972615 (EZH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106972615 (EZH1)
Enzymes [BR:aju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106972615 (EZH1)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106972615 (EZH1)
   Polycomb group proteins
    PRC2-EZH1 complex
     106972615 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 106972615
NCBI-ProteinID: XP_014925107
LinkDB All DBs
Position
Unknown
AA seq 750 aa AA seqDB search
MSKMDISNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILN
EEWKKLRVQPVQLMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPL
QQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFL
ELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHALEGNKKSSKKQFPNDMIF
SAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTL
FCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKC
SGRRRRRHHMVSASCSNTSASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASP
APPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESL
ILKLPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPC
IMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDC
KVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGK
VYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAI
QAGEELFFDYRYSQADALKYVGIERETDVL
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatggatatctcaaaccccccaacttccaaatgtatcacttactggaaaaga
aaagttaaatctgaatacatgcgactccgacaactgaagcggcttcaggcaaatatgggc
gcgaaggctctatatgtagcaaattttgcaaaggttcaagaaaaaacccagatcctcaat
gaagaatggaagaagcttcgtgtccaacctgtgcagttgatgaagcctgtgagtgggcat
ccttttctcaaaaagtgtaccatagagagcattttcccaggatttgcaagccaacatatg
ttaatgaggtctctgaacacagttgccttggttcccatcatgtattcctggtcccctctc
cagcagaactttatggtagaagatgagacagttttgtgcaatattccctacatgggagat
gaggtgaaagaagaagatgagactttcattgaggagctcatcaataactatgatgggaaa
gtccacggtgaagaagagatgatccctggatctgttctgattagtgatgctgttttcctg
gagttagtagatgctctgaatcaatactcagatgaagaggaggaagggcacaatgacacc
tcagatgggaagcaagatgacagcaaagaagatctgccagtgacaagaaagagaaaacga
cacgctcttgaaggcaacaaaaagagttccaagaaacagttcccaaacgacatgatcttc
agtgcaattgcctcgatgttccctgagaacggtgtcccggatgacatgaaggagaggtac
cgggagctgacggagatgtcagaccccaatgcgcttccccctcagtgcacacccaacatc
gacggccccaacgccaagtccgtgcagcgggagcagtctctgcactccttccacacactt
ttttgccgacgctgcttcaaatacgactgcttccttcacccttttcacgccacccctaat
gtatataaacgcaagaacaaagagatcaagattgaaccagaaccatgtggcacagactgc
ttccttttgctggaaggagcgaaggagtacgccatgctccacaaccctcgctctaagtgc
tccgggcgtcgccgacgaaggcaccacatggtcagtgcttcctgctccaacacttcagcc
tctgctgtggctgagactaaagaaggggacagtgacagggatacaggcaatgactgggcc
tccagttcttcagaggccaactctcgctgccagacccccacaaagcagaaggctagtccg
gccccccctcagctctgtgtagtggaagcaccctcggagcctgtggaatggactggggct
gaggaatctctctttcgagtgtttcatggcacctacttcaacaacttctgttccatagcc
agacttctgggaactaagacatgcaagcaggtctttcagtttgcagtcaaagaatcactt
atcctgaagctgccaacagatgagctcatgaacccgtcgcagaagaagaaaagaaagcac
aggttgtgggctgcacactgcaggaaaattcagctgaagaaagataactcttccactcaa
gtgtataactaccagccctgcgaccatccagaccgcccctgtgacagcacctgcccctgc
atcatgacgcagaatttctgtgagaagttctgccagtgcaacccggactgtcagaatcgt
ttccctggctgtcgctgtaagacccagtgtaataccaagcagtgtccctgctacctggca
gtgcgagagtgcgaccccgacctgtgcctcacctgcggggcctcggagcactgggactgc
aaggtggtttcctgcaaaaactgcagcatccagcgaggcctcaagaagcacctgctgctg
gccccctcagatgtggccggatggggcaccttcattaaggagtctgtgcaaaagaacgaa
ttcatttctgaatactgtggtgagcttatctctcaagacgaggctgatcgacgggggaag
gtctatgacaaatacatgtccagcttcctcttcaacctcaacaatgattttgtagtagat
gctacccggaaaggaaacaaaattcgatttgcaaaccattcagtgaaccccaactgttat
gccaaagtggtcatggtgaacggggatcatcgcattggaatctttgctaaaagggcaatt
caagctggtgaagagctcttctttgattacaggtacagccaagctgatgccctcaagtac
gtggggatcgagcgggagactgatgtcctttag

DBGET integrated database retrieval system