KEGG   Acinonyx jubatus (cheetah): 106972687Help
Entry
106972687         CDS       T04657                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aju00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106972687 (SETDB2)
Enzymes [BR:aju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106972687 (SETDB2)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106972687 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106972687 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD Ribosomal_S17
Motif
Other DBs
NCBI-GeneID: 106972687
NCBI-ProteinID: XP_014925180
LinkDB All DBs
Position
Un
AA seq 704 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDSIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
ISNNSTLIKDHTSVNQNEQENKSGSLPSTSYEDSFPEDCTFLSTKNKEVPPLENKVAYIT
EKKSSLNLRYQSHDCSRTCLMKMPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYR
TPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPQFKYRRTMWPRAYYLNSFSNMFTDSCDCSEGCIDITKCACLQLTA
RNAKTCPLSSNKITTGYKFKRLQRQIPTGIYECSLLCKCNRQMCQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSNTGKPDPTDENGKEENIMKNMFSKKRKI
EVADCEVEVIPLDLETHRSAETEECPPTFRNNLKEPVIETKCNNISRIQCHSVIRSPKAK
TAIIQRNGKKMGFTSSESVTSEDNDGFKPTQLHLNSKAKEMKKDSSSYQVKDTENSLLIE
SDVIDITKCREEIPSGERCNQATPLDNQNIIKEFKSQIQKPQGERSPAFQNQQVLCDKEF
PSETKNTSPDSLKKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETRDRNFPLV
AFFTNRYVKARTELTWDYGYEAGTVPEKEILCQCGVNKCRKKIL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggagctggaagatgatggaaaa
gtggactccatctttgaacaagtgcaaaatgtgttacaatcactgaaacaaaagattaaa
gatgggtctgccacaaataaagaatacatccaagcaatgattctagtgaatgaagcaacc
ataagtaacaattcaacattgataaaggatcatacatcggtgaaccagaatgaacaggaa
aacaaatcaggttcattgccttctacgtcatatgaagactcctttccagaagactgtaca
tttctatctacaaaaaataaggaagttcctcctttggaaaataaagttgcatacattaca
gaaaagaaatcatctttgaatttacgttaccaaagtcatgactgctctagaacttgtctg
atgaaaatgccactaaccttcaagggagaaaaccctctgcagctaccaatcaaatgccac
ttccaaagacgacatgcaaagacaaactctcattcttcagcactccacgtgagttataga
accccttgtggaaggagtctacgaaacgtggaggaagtttttcgttacctgcttgagaca
gaatgtaactttttatttacagataacttttctttcaatacctatgttcagttgactcgg
aattacccaaaacaagaagaaattgtttctgatgtggatattagcaatggagtggaatcg
gtacccatttctttctgtaatgaaattgacaatagaaagcttccacagtttaagtacaga
aggactatgtggccacgagcatattatctaaacagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgtgcatgtcttcagttgacagca
aggaatgccaagacttgccccttgtcgagtaataaaataaccactggatataaatttaaa
agactacagagacaaatacctactggcatttatgaatgcagcctgttgtgcaagtgtaat
cgacaaatgtgtcaaaaccgagttgtgcagcatggacctcaagtgaggctacaggtgttc
aaaactgaaaagaagggatggggagtacgctgcctagatgacattgacagagggacattt
gtttgcatttattcaggaagattactaagcagatctaacactgggaaacctgatcctact
gatgaaaatggaaaggaagagaatattatgaaaaatatgttttcaaaaaagaggaaaata
gaagttgcagattgtgaggtagaagttatcccattagacctggaaacacatagaagtgct
gagactgaggagtgtccacctacattccgtaataatttaaaagaacctgttatagaaacg
aaatgtaacaatatttcaagaattcagtgtcattcagtcattagaagtcctaaagccaag
acagccattattcaacgcaatgggaaaaagatgggatttacttcctcagagtctgtcacc
tcagaagataatgatggatttaaaccgacccaactacatctgaactccaaagccaaggag
atgaaaaaggattcaagctcttaccaagttaaagacactgaaaacagtctgctgattgaa
tcagatgtgatagatataaccaaatgtagagaagaaataccatcaggggaaagatgtaac
caagcaaccccactggataatcagaatattataaaggaattcaagtctcaaatacaaaag
ccccaaggggaaagatctccagcatttcaaaaccagcaggtcttgtgtgataaagagttc
ccaagcgaaaccaagaacacttcacctgattctctaaagaagttcaataaagggaatgtg
tttttattggatgccacaaaagaaggaaatgtgggccgcttccttaatcatagttgttgc
ccaaatcttttggtacagaatgtttttgtagaaacacgtgacaggaattttccattggtg
gcattcttcaccaacaggtatgtgaaagcaagaacagaactaacatgggattatgggtat
gaagctgggactgtgcctgagaaagaaatcctctgccagtgtggggttaataaatgtaga
aagaaaatattataa

DBGET integrated database retrieval system