KEGG   Acinonyx jubatus (cheetah): 106972797
Entry
106972797         CDS       T04657                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01522  Endocrine resistance
aju01524  Platinum drug resistance
aju04012  ErbB signaling pathway
aju04066  HIF-1 signaling pathway
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04630  JAK-STAT signaling pathway
aju04921  Oxytocin signaling pathway
aju04928  Parathyroid hormone synthesis, secretion and action
aju04934  Cushing syndrome
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05163  Human cytomegalovirus infection
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05203  Viral carcinogenesis
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05210  Colorectal cancer
aju05211  Renal cell carcinoma
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05218  Melanoma
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106972797 (CDKN1A)
   04630 JAK-STAT signaling pathway
    106972797 (CDKN1A)
   04066 HIF-1 signaling pathway
    106972797 (CDKN1A)
   04068 FoxO signaling pathway
    106972797 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    106972797 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106972797 (CDKN1A)
   04115 p53 signaling pathway
    106972797 (CDKN1A)
   04218 Cellular senescence
    106972797 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    106972797 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    106972797 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106972797 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    106972797 (CDKN1A)
   05206 MicroRNAs in cancer
    106972797 (CDKN1A)
   05205 Proteoglycans in cancer
    106972797 (CDKN1A)
   05203 Viral carcinogenesis
    106972797 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106972797 (CDKN1A)
   05212 Pancreatic cancer
    106972797 (CDKN1A)
   05225 Hepatocellular carcinoma
    106972797 (CDKN1A)
   05226 Gastric cancer
    106972797 (CDKN1A)
   05214 Glioma
    106972797 (CDKN1A)
   05216 Thyroid cancer
    106972797 (CDKN1A)
   05220 Chronic myeloid leukemia
    106972797 (CDKN1A)
   05217 Basal cell carcinoma
    106972797 (CDKN1A)
   05218 Melanoma
    106972797 (CDKN1A)
   05211 Renal cell carcinoma
    106972797 (CDKN1A)
   05219 Bladder cancer
    106972797 (CDKN1A)
   05215 Prostate cancer
    106972797 (CDKN1A)
   05213 Endometrial cancer
    106972797 (CDKN1A)
   05224 Breast cancer
    106972797 (CDKN1A)
   05222 Small cell lung cancer
    106972797 (CDKN1A)
   05223 Non-small cell lung cancer
    106972797 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106972797 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106972797 (CDKN1A)
   05161 Hepatitis B
    106972797 (CDKN1A)
   05160 Hepatitis C
    106972797 (CDKN1A)
   05163 Human cytomegalovirus infection
    106972797 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106972797 (CDKN1A)
   05169 Epstein-Barr virus infection
    106972797 (CDKN1A)
   05165 Human papillomavirus infection
    106972797 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106972797 (CDKN1A)
   01522 Endocrine resistance
    106972797 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106972797
NCBI-ProteinID: XP_014925292
UniProt: A0A6J1Z8V8
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSRDAHQIPHGSKACRRLFGPVDSEQLRRDCDALMAGCVQEARERWNFDFVTETPLE
GDFAWERVWGLGLPKLYLPAGPRGGRDDLGGGKRPSTSSTLLSGTAREDHLDLSLSCTLM
PHSPERPEASPGAPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccatccagggatgcccaccagatcccacatggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgcgccgagactgtgacgcgttaatggcaggc
tgcgtgcaggaggcccgggagcgatggaacttcgactttgtcaccgagacaccgctggag
ggcgactttgcctgggagcgtgtgtggggcctgggcctgcccaagctctacctgcctgca
gggccccgggggggccgggatgacctgggagggggcaagcggcccagcacctcgtctacc
ctgctgtcggggacagctcgggaggaccacctggacctgtccctgtcctgcactctcatg
cctcactcccctgagcggcccgaggcgtctccaggtgcacctggcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system