KEGG   Acinonyx jubatus (cheetah): 106972947
Entry
106972947         CDS       T04657                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04110  Cell cycle
aju04144  Endocytosis
aju04218  Cellular senescence
aju04350  TGF-beta signaling pathway
aju04371  Apelin signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04659  Th17 cell differentiation
aju04926  Relaxin signaling pathway
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05142  Chagas disease
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106972947 (SMAD2)
   04390 Hippo signaling pathway
    106972947 (SMAD2)
   04371 Apelin signaling pathway
    106972947 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106972947 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    106972947 (SMAD2)
   04218 Cellular senescence
    106972947 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106972947 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    106972947 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    106972947 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106972947 (SMAD2)
   05205 Proteoglycans in cancer
    106972947 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106972947 (SMAD2)
   05212 Pancreatic cancer
    106972947 (SMAD2)
   05225 Hepatocellular carcinoma
    106972947 (SMAD2)
   05226 Gastric cancer
    106972947 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    106972947 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106972947 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106972947 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    106972947 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 106972947
NCBI-ProteinID: XP_026924718
UniProt: A0A6J2A870
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTAGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgcccttcactccgccagtcgtgaagagactgctgggatggaagaaa
tcagccggtggctctggaggagcgggtggaggagagcagaacggacaagaagaaaagtgg
tgtgagaaagcggttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacagcaggc
ctttacagcttctctgaacaaaccaggtctctggatggccgtctgcaagtgtctcatcga
aaaggactgccacatgtgatatattgccgattgtggcgttggcctgaccttcacagtcac
catgaactcaaagccattgaaaactgcgaatatgctttcaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgaaacaccagttttgcctccggtattggtg
ccacggcacaccgagatcctgaccgaactgcctcccctggatgattacacccactccatt
ccagaaaacactaatttcccagcgggaattgagccacagagtaattacatcccagaaacg
ccacctcctggatatatcagtgaggatggagaaacgagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactgtctcctactactctttcccctgttaatcatagt
ttggatttgcagccagttacttactcagaacctgcattttggtgttcaatagcatattat
gaattaaaccagagggttggagagaccttccacgcatcacagccctcactcactgtagac
ggtttcacagatccatccaattcagagaggttctgcctagggttgctctccaacgtcaac
cgaaatgccaccgtagaaatgacaagaagacatataggaagaggagtacgcttatattac
ataggtggagaagtttttgcagagtgcctaagcgatagtgcaatctttgtgcagagcccc
aactgtaatcagagatacggctggcacccggcaacagtgtgtaaaatcccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgtcaatcag
ggttttgaagccgtgtatcaactaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagcactccttgctggatcgaactt
catctgaatgggcctctgcagtggttggacaaagtgttaactcagatgggatccccttca
gtgcgttgttcaagcatgtcctaa

KEGG   Acinonyx jubatus (cheetah): 106980367
Entry
106980367         CDS       T04657                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X2
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04144  Endocytosis
aju04218  Cellular senescence
aju04310  Wnt signaling pathway
aju04350  TGF-beta signaling pathway
aju04371  Apelin signaling pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04659  Th17 cell differentiation
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05161  Hepatitis B
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05220  Chronic myeloid leukemia
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106980367 (SMAD3)
   04350 TGF-beta signaling pathway
    106980367 (SMAD3)
   04390 Hippo signaling pathway
    106980367 (SMAD3)
   04371 Apelin signaling pathway
    106980367 (SMAD3)
   04068 FoxO signaling pathway
    106980367 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106980367 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    106980367 (SMAD3)
   04218 Cellular senescence
    106980367 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106980367 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    106980367 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    106980367 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106980367 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106980367 (SMAD3)
   05212 Pancreatic cancer
    106980367 (SMAD3)
   05225 Hepatocellular carcinoma
    106980367 (SMAD3)
   05226 Gastric cancer
    106980367 (SMAD3)
   05220 Chronic myeloid leukemia
    106980367 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    106980367 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106980367 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106980367 (SMAD3)
   05161 Hepatitis B
    106980367 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 106980367
NCBI-ProteinID: XP_014933850
UniProt: A0A6J0A1C0
LinkDB
Position
Unknown
AA seq 320 aa
MELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTN
FPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVT
YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVEL
TRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNN
QEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQ
WLDKVLTQMGSPSIRCSSVS
NT seq 963 nt   +upstreamnt  +downstreamnt
atggagctatgcgagttcgccttcaacatgaagaaggacgaggtctgcgtgaatccctac
cactatcagagggtagagaccccagttctacctcctgtgctggtgccacgccacacagag
atcccggccgagttccccccgctggacgactacagccattccatccccgagaacactaac
ttccccgcgggcatcgagccccagagcaatattccagaaaccccaccccctggctacctg
agtgaagatggagagaccagtgaccaccagatgaaccacagcatggatgcaggttctcca
aacctatccccgaatccgatgtccccagcgcacaacaatttggacctgcagcctgtcacc
tactgcgagccagccttctggtgctccatttcctactacgagctgaaccagcgcgtcggg
gagaccttccacgcctcccagccctccatgaccgtggacggcttcactgacccctccaac
tcggagcgcttctgcctggggctgctctccaatgtcaacaggaacgcggctgtggagctc
acacggaggcatatcgggcgaggcgtgcggctgtactacatcggaggggaggtcttcgcc
gagtgcctcagtgacagcgccatctttgtccagtctcccaactgcaaccagcgctacggc
tggcacccagccaccgtctgcaagatcccgccaggatgcaacctgaagatcttcaacaac
caggagtttgccgccctcctggctcagtctgtcaaccagggcttcgaggcggtctaccag
ctgacccggatgtgcaccatccgcatgagcttcgtcaaaggctggggagcagagtacagg
agacagacagtgaccagcaccccctgctggattgagctgcacctgaatgggccgttgcag
tggcttgacaaggtcctcacccagatgggctccccaagcatccgctgttccagtgtgtct
tag

DBGET integrated database retrieval system