KEGG   Acinonyx jubatus (cheetah): 106973163
Entry
106973163         CDS       T04657                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X4
  KO
K02085  adenomatosis polyposis coli protein
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04810  Regulation of actin cytoskeleton
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05206  MicroRNAs in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106973163 (APC)
   04390 Hippo signaling pathway
    106973163 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106973163 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106973163 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106973163 (APC)
   05206 MicroRNAs in cancer
    106973163 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106973163 (APC)
   05225 Hepatocellular carcinoma
    106973163 (APC)
   05226 Gastric cancer
    106973163 (APC)
   05217 Basal cell carcinoma
    106973163 (APC)
   05213 Endometrial cancer
    106973163 (APC)
   05224 Breast cancer
    106973163 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106973163 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    106973163 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106973163 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106973163 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106973163 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106973163 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aju04812]
    106973163 (APC)
Protein phosphatases and associated proteins [BR:aju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106973163 (APC)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106973163 (APC)
Cytoskeleton proteins [BR:aju04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     106973163 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u15 APC_rep APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 106973163
NCBI-ProteinID: XP_014925707
UniProt: A0A6I9ZS89
LinkDB
Position
Unknown
AA seq 2854 aa
MYACLGSGPVAVLPASAPPSTLGSWSSGGGRVPQERKRPGGVRTSGRGANVWQEVLKQLQ
GSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSP
VPMGSFPKRGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSL
PLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRVTRIQQIEKDILRIR
QLLQSQATEAERSSQSKHEAGSHEAERQNEGQGVAEINMATPGSGQGSAARMDHETASVL
SSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGC
LPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQ
IRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGL
QAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQ
LKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSAL
WNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDH
RQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIH
SKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSET
FDNIDNLSPKASHRSKQRHKPNLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLP
SSSSSRGSLDSSRSEKDRSLERERGISLGNYHPATENPGTSSKRGLQISTTAAQIAKVME
EVSAIHTSQEDRSSGSTGELHCGTDERNALRRSSTAHTHANTYNFTKSENSNRTCPMPYA
KLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSAN
HMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRSQS
TTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVSSNHGINQNVNQSLCQE
DDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDIPASQK
PPFSFSKSSSGQSTKTEHISSSSENTSTPSSNAKRQNQHHPSSTQSRNGQTPKATSCKVP
SINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQETDSANTLQIAEIKENSG
TRSTEESVSEVPTVSQHIRTKSSRLQASGLSAESTRHKAVEFSSGAKSPSKSGAQTPKSP
PEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMP
PSRSKTPPPPPPPQTVQSKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLH
FATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPEEANESQV
KEAEKRTDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTAPKLPPPVARKPS
QLPVYKLLPSQNRLQAQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELA
AGEGVRAGAQSGEFEKRDTIPTEGRSTDEAQRIKTPSATISELDDNKTEEGDILAECINS
AMPKGKSHKPFRVKKIMDQVQQASMSSSGANKNQLDGKKKKPTSPVKPIPQNTEYRTRVR
KNTDSKNNLNAERTFSDNKDSKKQNLKNNSKDFNDKLPNNEDRVRGSFTFDSPHHYTPIE
GTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKENKESEAKVTSHTELTSSQQSANKT
QAVTKHPINRGQSKPMLQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSRNSSLS
SLSDIDQENNNNKEGEPVKETEAPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSS
LSIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMSGILAEDLTLDLKDIQRPDSE
HGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFH
LTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESENKGIKGGKKVYRSLITGKVRSNSEI
SSQIKQPLQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQPATT
SPRGTKPSVKSELSPVTRQTSQPAGANKGSSRSGSRDSTPSRPAQQPLSRPMQSPGRNSI
SPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNGS
SIPRSESASKGLNQMNNGNGSNKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPS
PTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHSSVQSGGWRKLPP
NLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGS
SSSILSASSESSEKAKSEDEKHVNSISGTKQTKENQVSTKGTWRKIKENEISPTNSTSQT
TSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRTGRSPTGNTPPVIDTVSEK
GNPNAKDSKDNQGKQNVGNGNAPIRTMGLENRLNSFIQVDAPDQKGTEAKPGQSNPVPVS
ETNESSIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPV
NNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV
NT seq 8565 nt   +upstreamnt  +downstreamnt
atgtacgcctgtctgggctcgggtccggtcgccgttttgcctgcttctgcaccaccctct
accctcgggtcctggagctccggcggcggccgtgtcccgcaggagaggaagcgcccaggc
ggcgtccgtacttctggccgcggggcgaacgtctggcaggaagtacttaaacagctacaa
ggaagtattgaagatgaagctatggcttcttctggacagattgatttattagagcgtctc
aaagaacttaatttagatagcagtaatttccctggagtgaaactacgctcaaaaatgtcc
ctccgttcttatggaagccgcgaaggatctgtatctagtcgttcaggagagtgcagtcct
gttcctatgggttcgtttccaaaaagagggtttgtaaatggaagcagagaaaatactggt
tatttagaagaacttgagaaagaaagatcattacttcttgctgatcttgacaaagaagaa
aaggaaaaagactggtattatgctcaacttcagaatctcactaaaagaatagatagtctt
cctttaactgaaaatttttccttacaaacagatatgaccagaagacaattggaatatgaa
gcaaggcaaatcagagttgcaatggaagaacaactaggtacttgccaggatatggagaaa
agagcacagcgaagagtaaccagaattcaacaaatagagaaggacatacttcgtatacga
cagcttttacagtcccaagccacagaagcagagaggtcatctcagagcaagcatgaagcc
ggctcacacgaagctgagcggcagaatgaaggtcaaggagtggcagaaatcaacatggca
actcctggtagtggtcagggttcagctgcgcgaatggatcatgaaacagccagtgttttg
agttctagtagcacacactctgctcctcgaaggctgacaagtcatctgggaaccaaggtg
gaaatggtgtattcattgttatcaatgcttggtactcatgataaggatgatatgtcgcga
actttgctagctatgtctagctcccaagacagctgtatatccatgcgacagtctggatgt
cttcctctcctcatccagcttttacatggcaatgacaaagactctgtgttgttgggaaat
tcccggggcagtaaagaggctcgggccagggccagtgcagcacttcacaacatcattcac
tcacagcctgatgacaagagaggcaggcgtgaaatccgagtccttcatcttttggaacag
atacgagcttactgtgaaacctgttgggagtggcaggaagcccatgaacaaggcatggac
caggacaaaaatccaatgccagctcctgttgaacatcagatctgtcctgctgtgtgtgtt
ctaatgaaactttcatttgatgaagaacatagacatgcaatgaatgaacttgggggacta
caggccattgcagaattattgcaggtggattgtgaaatgtatgggctaactaatgaccac
tacagtattacattaagacgatatgctggaatggctttgacaaacttgacttttggagat
gtagccaacaaggctacactctgctctatgaaaggctgcatgagagcacttgtggcccaa
ctaaaatctgaaagtgaagacttacagcaggttattgcaagtgttttgaggaatttgtct
tggcgagcagatgtaaatagtaaaaagacattgcgtgaagttggaagtgtgaaagcatta
atggaatgtgctttggaagttaaaaaggaatcaaccctcaaaagcgtattgagtgcctta
tggaatttgtcagcacattgcactgagaataaagctgatatatgtgctgtagatggtgcg
cttgcatttctggttggcactctcacttaccgaagccagacaaatactttagccattatt
gaaagtggaggtggaatattacggaacgtgtccagcttgatagctacaaatgaggaccac
aggcaaatcctaagagagaacaactgcctgcaaaccttattacaacacttgaaatctcac
agtttgacaatagtcagtaatgcatgtggaaccttgtggaatctctcagcaagaaatcct
aaagaccaggaagcattatgggacatgggggcagtcagcatgctcaagaacctcattcat
tcaaagcacaaaatgattgctatgggaagcgctgcagctttaaggaatctcatggcaaat
agacctgcaaagtataaggatgccaatataatgtctcctggttcaagcttgccatctctt
catgtcaggaaacaaaaagccctagaagcagaattagatgctcagcatttatcagaaact
tttgacaatattgacaatttaagtcccaaggcatctcatcgtagtaagcaacgacacaag
ccaaatctttatggtgactatgtttttgacaccaatcgacatgatgataatagatcagac
aattttaatactggaaacatgactgtcctttcaccatatttaaatactacagtgttgccc
agctcctcttcatcaagaggaagtttagacagttctcgttctgaaaaagatagaagtttg
gagagagaacgaggaattagcctaggcaactaccacccagcaacagaaaatccaggcact
tcttcaaagcgaggtttgcagatttccaccactgcagcccagattgccaaagtcatggaa
gaagtatcagccattcacacctcccaggaagacagaagttctgggtctaccggcgagtta
cattgtgggacagatgagaggaatgcactaagaagaagctccactgcccacacacatgca
aacacttacaacttcactaagtcagaaaattcaaataggacatgtcctatgccttatgcc
aaattggaatataagagatcttcaaatgatagtttaaatagtgtcagtagtagtgatggt
tatggtaaaagaggtcagatgaagccttccattgaatcctattctgaagatgatgaaagt
aaattttgcagctatggtcagtatccagctgacctagcccataaaatacacagcgcaaat
catatggatgataatgatggagaactagatacaccaataaattatagtcttaaatactca
gatgagcagttgaactccggaaggcaaagcccttcacagaatgaaagatgggcaagaccc
aaacatataatagaagatgaaataaaacagagtgagcaaagacaatcaagaagtcaaagc
acaacttaccccgtatatactgagagcactgatgataaacatctcaagtttcagccacat
tttggacagcaggaatgtgtttccccatataggtcaagaggagccaatggttcagaaaca
aatcgagtaagttccaatcatggaattaatcaaaatgtaaaccagtctttgtgtcaggaa
gatgactatgaagatgataagccaaccaactatagtgaacgttactccgaggaagagcag
catgaagaagaagagagaccaacaaattatagcataaagtataatgaagagaaacatcat
gtggatcaacctatcgattatagtttaaaatatgccacagacattcctgcctcacagaaa
ccaccattttcattctcaaagagttcatctggacaaagcactaaaactgaacacatctct
tcaagcagtgagaatacatccacaccttcatctaatgccaagaggcagaatcagcaccat
ccaagttccacacaaagcagaaatggtcagaccccaaaagccacctcctgcaaagttcct
tctatcaaccaagaaacaatacagacttactgtgtagaggatactccaatatgtttctca
cgttgcagttcactatcatctttgtcatcggccgaagatgaaataggatgtgatcagaca
acacaggaaacagattctgctaatactctacaaatagcagaaataaaagaaaacagtggg
actagatcaacagaagagtctgtgagtgaagttccaacagtgtcacagcacattagaacc
aaatccagcagacttcaggcttctggtttatctgcagaatcgaccaggcataaagctgtt
gaattttcttcaggggctaaatctccatcaaaaagtggtgctcagacccctaaaagtcca
ccagagcactacgttcaggagactccactcatgtttagcagatgcacttctgtcagttca
cttgatagttttgagagtcgctcgattgccagctccgttcagagtgaaccctgcagtgga
atggtaagtggcattataagccccagtgaccttccagatagccctggacaaaccatgcca
ccaagcagaagtaaaacccctcctcctcctcctcctcctcagacagttcagagtaagcga
gaggtacctaaaaacaaagcccctactgcggaaaagagagagagtggaccgaagcaagct
gctgtaaatgctgcagtacagagagtccaggtgcttccagatgctgatactctcttacat
tttgccacagaaagtactccagatggattttcttgttcatctagcctgagtgctctgagc
ctcgatgagccatttatacagaaagatgtggaattaagaataatgcctccagttcaggaa
aatgacaatgggaatgaaaccgaatctgagcagcctgaagaagcaaatgaaagccaggta
aaagaagcagaaaaacgtactgattctgaaaaagatctgttagatgactcagatgatgat
gatattgaaatattagaagaatgtattatttctgccatgccaacaaaatcttcacgtaaa
gccaaaaaaccagcccagactgctccaaaattacctccacctgtggcaaggaaaccaagt
caactccctgtgtataaacttcttccatcacaaaacaggttacaggcacaaaaacatgtt
agttttacaccaggagatgatatgccacgggtgtattgtgtagaagggacacctataaac
ttttccacagctacatctttaagtgatctaacaatagaatctcctccaaatgagttagct
gctggagaaggggttagagcaggagcacagtccggtgaatttgaaaaacgagataccatt
cctacagaaggcagaagtacagatgaggctcaaagaataaaaaccccatctgcaacgata
tctgaactggatgacaataaaacagaagaaggtgatattcttgcagaatgcattaactct
gctatgcccaaaggaaaaagtcacaagcctttccgtgtgaagaagataatggaccaggtc
caacaagcatctatgtcttcatctggagctaacaaaaatcagttagatggtaagaaaaag
aaacctacttcaccagtaaaacctataccacaaaatactgaatataggacacgtgtaaga
aaaaacacagactcaaaaaataatttaaatgctgaaagaactttctcagacaacaaagat
tcaaagaaacagaacttgaaaaataattccaaggacttcaatgataagctaccaaataat
gaagatcgagtcagaggaagttttacttttgattcacctcatcattacactcccattgaa
ggaactccatactgtttttcacgaaatgattctttgagttctctagattttgatgatgat
gatgttgacctttctagagaaaaggctgaattaagaaaggggaaagaaaataaagaatca
gaagctaaagttaccagccacacagaactaacctctagccaacaatcagctaataagaca
caagctgttacaaaacatccaataaatcgaggtcagtctaaacccatgctgcagaagcaa
tccacttttccacagtcatccaaagacataccagacaggggagcagcaactgatgagaaa
ttacaaaattttgctattgaaaatactccggtgtgcttttctcgaaattcctctttaagt
tctcttagtgacattgatcaagaaaacaacaataacaaagaaggtgaacctgtcaaagag
acagaggcccctgactcacagggagaacccagtaaacctcaggcatcaggttatgctcct
aaatcatttcatgttgaagatacccctgtttgtttctcacgaaatagttctctcagttct
cttagtattgattctgaagatgacctgttgcaggaatgtataagttctgcaatgccaaaa
aagaaaaagccttcaagactcaagggtgataatgaaaagcatagtcccagaaatatgagt
ggcatattggcagaagatttgacacttgatttgaaagatatacagagaccagattcagaa
catggtttatccccggattcagaaaattttgattggaaagctattcaggaaggtgcaaat
tccatagtaagtagtttacatcaagctgctgctgctgcatgtttatctagacaggcatca
tctgactcagactccatcctttcactgaaatcagggatctccctgggatcaccatttcat
cttacacctgatcaagaggaaaaaccctttacaagtaataagggcccacgaattctaaaa
cctggggagaagagtacattggaaactaaaaagatagaatctgaaaataaaggaatcaaa
ggaggaaaaaaagtttatagaagtttaattaccggaaaagttcgttctaattcagaaatt
tcaagccaaataaaacagcctcttcaaacaaacatgccttcaatctctcggggcaggaca
atgattcatattccaggagttcgaaatagctcttcaagtacaagtccggtttctaaaaaa
ggcccaccccttaagactccagcctccaaaagccctagtgaaggtcagccagccaccact
tctcctagaggaaccaagccatctgtgaagtcagaattaagccctgttaccaggcagaca
tcccaaccagctggagcaaataaagggtcttctagatcaggatctagagattccactcct
tcaagacctgcccaacaaccattaagtagacccatgcagtctccggggcggaactcaatt
tctcctggtcgaaatggaataagccctcctaataaattatcccagttgccaaggacttca
tcccctagtactgcttcaactaagtcctcaggttctgggaagatgtcatacacatctcca
ggcagacagatgagccagcagaaccttaccaagcaaacgggtttatccaagaatggcagc
agtatcccaagaagtgagtctgcctccaaaggactaaatcagatgaataatgggaatgga
tccaataaaaaggtagaactttctagaatgtcctcaactaaatcaagtggaagtgaatct
gataggtcagagagacccgtattagtacgccagtcaactttcatcaaagaagctccaagc
ccaaccctaaggagaaaattggaggaatctgcttcatttgaatctctttctccatcttct
agaccagattctcccactaggtcccaggcacagactccagttttaagtccttcccttcct
gatatgtctctgtccacacattcatctgttcagtctggtggatggcgaaaactcccacct
aatctcagtcccaccatagagtataatgatggaagaccagcaaagcgccatgatatagca
cgctcccattctgaaagtccttctagacttccaattaataggtcaggaacctggaaacgt
gagcacagcaaacattcatcatcccttccacgagtaagcacttggagaagaactggaagt
tcatcctcaattctttctgcttcatcagaatccagtgaaaaagcaaaaagtgaagatgaa
aaacatgtgaactctatttcaggaaccaaacaaactaaagaaaaccaagtatccacaaaa
ggaacatggagaaaaataaaagaaaatgagatttctcccacaaatagtacctctcagacc
acttcctcaggtgctgcaaatggtgctgaatcaaagactctgatttatcaaatggcacct
gctgtttctaaaacagaggatgtttgggtgagaattgaggactgtcccatcaacaaccct
agaactggaagatccccaacaggaaatactccccctgtgattgacactgtttcagaaaag
ggaaatccaaacgctaaagattcaaaagataatcagggaaaacaaaatgtgggtaacggc
aatgctcccatacgcaccatgggtttggaaaaccgcctgaactcctttattcaggtagat
gccccagaccaaaaaggaactgaggctaaaccgggacaaagtaaccctgtccctgtgtca
gagactaatgaaagttccatagctgagcgtacccctttcagttctagcagttcaagcaag
cacagttcacctagtgggactgttgctgccagagtgactccgtttaactacaatccaagc
cctaggaaaagcagcgcagatagcacttcagctcggccatctcagatcccgacaccagtg
aacaacaacacgaagaaacgagattcaaaaactgacagcacagaatccagtggaactcaa
agtcctaagcgccattctgggtcttaccttgtgacatctgtttaa

KEGG   Acinonyx jubatus (cheetah): 106983719
Entry
106983719         CDS       T04657                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2 isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04810  Regulation of actin cytoskeleton
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05206  MicroRNAs in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106983719 (APC2)
   04390 Hippo signaling pathway
    106983719 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106983719 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106983719 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106983719 (APC2)
   05206 MicroRNAs in cancer
    106983719 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106983719 (APC2)
   05225 Hepatocellular carcinoma
    106983719 (APC2)
   05226 Gastric cancer
    106983719 (APC2)
   05217 Basal cell carcinoma
    106983719 (APC2)
   05213 Endometrial cancer
    106983719 (APC2)
   05224 Breast cancer
    106983719 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106983719 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    106983719 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106983719 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106983719 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106983719 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106983719 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aju04812]
    106983719 (APC2)
Protein phosphatases and associated proteins [BR:aju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106983719 (APC2)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106983719 (APC2)
Cytoskeleton proteins [BR:aju04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     106983719 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC Suppressor_APC Arm APC_r Arm_APC_u3 SAMP bZIP_1 HALZ Sec2p Wtap Herpes_BLRF2
Other DBs
NCBI-GeneID: 106983719
NCBI-ProteinID: XP_026905173
UniProt: A0A6J1YKD0
LinkDB
Position
Unknown
AA seq 2287 aa
MGLLGLLSLLHSAFFGDQALQELKMTSSVAPYEQLVRQVEALKAENSHLRQELRDNSSHL
SKLETETSGMKEVLKHLQGKLEQEAGVLVSLGQTEVLEQLKALQMDITSLYNLKFQPPAL
GPEPTGRTPEGSPVHGSGPSKDSFGELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYY
SQLQGLSKRLDELPHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRA
SRLEQIDQELLSAQDRVQQTEPQALLAVKSVPVDEDPETEVPTHPEDGVPQPGNSKVEVV
FWLLSMLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTEAGVGGRDGSPG
ATGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGAEG
GGASGAPVPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHRMTRDP
LNLALRRYAGMTLTNLTFGDVANKAALCARRGCMEAIVAQLASESEELHQVVSSILRNLS
WRADIHSKKVLREVGSMTALMRCVLRASKESTLKSVLSALWNLSAHSTENKAAICQVDGA
LGFLVRTLTYKCQSNSLAVIESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSH
SLTIVSNACGTLWNLSARSPRDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAH
RPAKYQATATAVSPGACAPSLYVRKQRALEAELDTRHLAQALDHLEKQGLPEAEAEAASK
KPLPPLRHLDGLARDYASDSGCFDDDEAPSLAAAASTAEPASPAVLSLFLGSPFLQGQAL
ARAPPARRSGPEAEKEAGGEAAVAARAKAKLALAVARIDRLVEDISALHTSSDDSFSLSS
GDPGQEAPREGRAQSCSPCRRPEGRRQEAGGRAHPLLRLQAAHASLSNDSLNSGSSAGDG
RCPREHTRPCPLAVLAEHHEGAPCSQARPSRLDLSLPGGREPARRDGSAADACVRTIKLS
PTYQHVPLFEGHPRAGAGAGPLAAGARKQAWLPTEGLSQLPEKPAAETAPLRLSRCSSLS
SLSSAGRPGPSEAGDLDSDSSLEALEEAGPGKADLDGAWLGPGAASLPVAIPAPHRGRGL
GAEDTTPSSSSENCVQETPLVLSRCSSVSSLSSFESPSIASSVPSDPCSGLGSGTVSPSE
LPDSPGQTMPPSRSKTPPLAPAPPGERESTEFSLQWESYVKRFLDIADRRERCRLPSELD
AGSVRFTVEKPDENFSCASSLSALALHEHYVQKDVELRLLPPACPDRGGGPGPGPGPHLA
GHRRRDEAAGCLEGPAAADQELQLLRECLGAAVPARLRKVASALVPGRRALPVPVYMLVP
APARGDDSRTDSAEGTPVTFSSATSLSDETLQGPPRDPPAGQAAGRKTAGREAAARQATG
HRHGAWGGGRSAEQARGAGTRRAGLELPLRQPSSACTDRDGPRPGQARGDGAPQSLCLTT
PTEEAVYCFYDNDSDEEPSEAVAPPRRASAIPRAVKREHPAGRKDAQATPKAAAKALPAA
RAQPSLIADETPPCYSLSSSASSLSEPEPPEQPASRPRAPEPAVAKVVGPGGGCSGAPGP
RAGTGPGPGPLRRCVGSAVPGRRLQASGPRRRKPQAARPDKRPAERPQERGDEAAGSDQA
SDLDSVEWRAIQEGANSIVTWLHQAAAAATHEASSGSDSILSESGLSGSTLQPPVHRKGQ
RLQAGGAARPRPEKRDSTLAQHGPSGPEKLRGAQKMACRVPAVLRGRTVIYVPSPAPRAQ
PRGNPGTRVAPRKVGAPAQPAAPAKAPSPGQQQQQQQQQRSRSLHRPGKISELAALSPPQ
RSATPPARLAKAPSSGSSPASPASQPPPRRPPSGPQAAGPLPGPGASLAPQTPARALLSK
QHKTQKSPVRIPFMQRPARRGPPALARAAPEPGPRGRAGAEGSLGARGGRLGLVRVASAR
SSGSESSDRSGFRRQLTFVKESAGLPRRRRSEVAAPEAATSASQGGSPRRGRPALPAVFL
CSSRCDELRAAPRRPPAARPSPGERPARRPSSESPSRLPVRTPAARPEAVKRYASLPHIG
ALPGPAADAARRSSDGEARPLPRVAAPGTTWRRIRDEDVPHILRSTLPATALPLVGASPE
EGPGEPPQRKTSDAVVQTEDFVAAKTNSSTSPSLESRGPPQALGGGPTSFPGSDVDGPCP
PKAPTSAPFVHEGLGVAVGGFPTSRHGSPSRAARVPPFNYVPSPMVAAAADLAAEKAPAA
APASLLE
NT seq 6864 nt   +upstreamnt  +downstreamnt
atggggctcttggggctgctgagcctgctgcactcagccttcttcggggaccaggcgctg
caggagctgaagatgacgagctccgtggcgccctacgagcagctggtgcggcaggtggag
gccttgaaggccgagaacagtcacctgaggcaggagctgcgagacaactcgagccacctg
tccaagctagagacggagacgtccggcatgaaggaggtcctgaagcacttacaaggcaag
ctggagcaggaggccggagtgctggtgtccttggggcagacggaggtgctggaacagctg
aaagccctgcagatggacatcaccagcctgtacaacctcaagttccagcccccagccctg
ggtcctgagcccactggccggacccccgaaggaagtccagtacacggctccgggccttct
aaggacagctttggggagctgagccgggcgaccatccggctgctggaggaactggaccgg
gagaggtgcttcctgttgaacgagatcgagaaggaggagaaggagaagctctggtattac
tcacagctgcagggcctgtccaagcgcctggacgagctcccgcacgtggagacgcagttc
tcgatgcagatggacctgatccggcagcagctggagttcgaggcccagcacatccgctcg
ctgatggaagaacgcttcggcacctcggacgagatggtgcagcgcgcgcagatccgcgct
tctcgcttggagcaaatcgatcaggagctgctgtccgcacaggaccgggtgcaacagaca
gagccccaggccctgctggcggtgaagtcggtgccggtggacgaggatccagagactgaa
gtccccacacacccggaggatggtgtccctcagcccggcaacagcaaggtggaggtggtc
ttctggctgctgtccatgctggcaacgcgtgaccaggaggacacggcgcgcaccctgctg
gccatgtccagctcgccggagagctgcgtggccatgcgccgctcggggtgcctgccgctg
ctgctgcagatcctgcacggcaccgaggccggcgttgggggtcgcgacggaagccccggg
gcgacgggcgccaaggacgcacgcatgcgcgccaacgcggcgctgcacaacatcgtcttc
tcgcaacctgaccagggcctggcgcgcaaggagatgcgcgtcctgcacgtgctggagcag
atccgggcctattgtgagacctgctgggactggctgcaggccagggacggcgccgaggga
ggcggcgccagcggcgctccagtccccatcgagccccagatctgccaggccacctgtgcc
gtgatgaagctgtcttttgacgaggaataccgccgagccatgaacgagctgggtgggctg
caggccgtggcagagttactacaagttgactacgagatgcacagaatgacccgggacccg
ctgaacctcgccctccgtcgatacgccggcatgaccctcaccaacctcacctttggagac
gtggccaacaaggccgcactgtgtgcccgccggggctgcatggaggccatcgtggcccag
ctggcttctgagagcgaggagctgcaccaggttgtgtccagcatcctgcgcaacctgtcc
tggcgggccgacatccacagcaagaaggtgctgcgggaggtgggcagcatgaccgccctg
atgcggtgcgtccttcgagcctccaaggagtccaccctgaagagtgtgctcagcgccctg
tggaacctgtcggcgcacagcacggagaacaaggcggccatctgccaggtggacggcgcc
ctgggcttcctggtgaggacactgacctacaagtgccagagcaactcgctggccgtcatc
gagagtggcggcggcatcctgcgcaacgtgtccagcctcatcgccacgcgggaggactac
aggcaggtgctgcgggaccacaactgtctgcagacgctgctgcagcacctgacgtcccac
agcctgaccatcgtgagcaacgcgtgcggcacgctctggaacctgtcggcccgcagcccg
cgcgaccaggagctgctgtgggacctgggggccgtgggcatgctgcggaacctggtgcac
tccaagcacaagatgatcgccatgggcagcgccgcggccctgcgcaacctgctggcccac
cggcccgccaagtaccaggcgacggccaccgccgtgtcccccggcgcgtgcgcacccagt
ctgtacgtgaggaagcagcgggcgctggaggccgagctggacacgcgacatctggcccag
gcgctcgaccacctggagaagcagggcctgccggaggccgaggccgaggccgcctccaag
aagccgctgccacccctgcggcacctggacgggctggcccgggactacgcctccgactcc
ggctgcttcgacgacgacgaggcgccctccctggccgccgccgcctcgaccgcggagccc
gccagccccgccgtgctgtccctcttcctgggcagccccttcctgcagggacaggctctg
gcccgcgccccgcccgcccgccgcagcggcccggaggcggagaaggaggccggcggggag
gcggccgtggcggccagggccaaggccaagctggcgctggcggtggcgcggatcgaccgg
ctggtggaggacatctcagccctgcacacctcgtccgacgacagcttcagcctcagctcc
ggggaccccgggcaggaggccccgcgggagggccgcgcccagtcctgctccccttgccgg
cggccggagggcaggcggcaggaggccggcggccgggcccacccgctgctgcggctccag
gccgcccacgccagcctgtccaacgacagcctcaacagcggcagcagcgccggtgacggg
cgctgcccccgcgagcacacgaggccctgcccgctggccgtgctggccgagcaccacgag
ggggccccgtgcagccaggcgcggcccagccggctggacctcagcctgccgggcggccgg
gagccggccaggagggacggctctgcagccgacgcctgcgtgcgcaccatcaagctctcg
cccacctaccagcacgtgccgctcttcgagggccaccccagggcgggggcgggcgcgggg
cccctggccgccggggcccggaagcaggcctggctgcccacggagggcctgagccagctg
cccgagaagccggcggcagagacggcgcccctccgcctgtcccgctgcagctctctgtcc
tcgctgtcctcggccggccgccccggccccagtgaggccggggacctggacagcgactcg
tccctggaggcactggaggaggcgggacccggcaaggcggacctggacggagcctggctc
gggcctggggccgcctccctgcccgtggccatcccggcgccgcaccggggccgcggcctg
ggggcggaggacaccacgccgtccagctcctccgagaactgcgtgcaggagacgccgctc
gtgctgagccgctgcagctccgtgagctccctgagcagtttcgagagcccgtccatcgcc
agctccgtccccagcgacccgtgcagcgggctgggcagcggcacggtcagccccagcgag
ctgcccgacagccccgggcagaccatgccgcccagccgcagcaagacgcccccgctggcc
cctgcgccccccggcgagcgcgagagcaccgagttcagcttgcagtgggagagctacgtg
aagcgattcctggacatcgccgaccgccgggagcgctgccggctgccgtcggagctcgac
gccggcagcgtccgcttcacggtggagaagccggacgagaacttctcgtgcgcctcgagc
ctcagcgcgctggccctgcacgagcactacgtgcagaaggatgtggagctgcggctgctg
ccccccgcctgcccggatcgcggcggcggccccggccccggtcccggcccgcacctcgcg
gggcaccgccggcgggacgaggccgctgggtgcctggaggggccggcagccgccgaccag
gagctgcagctgctgcgcgagtgcctgggggcagccgtgcccgcccggctccgcaaggtg
gcctcggccctggtgcccggccgccgcgcgctgcccgtgcccgtgtacatgctggtgccc
gcccccgcccggggggacgactcacgcaccgactcggccgagggcacgccggtcaccttc
tccagtgccacctcgctcagcgacgagacgctgcagggacctcccagggacccacctgcc
gggcaggcagccggccggaagaccgcaggtcgggaggccgccgccaggcaggccaccggg
caccgccacggggcgtggggcgggggccggagcgcagagcaggcccggggggcgggcacg
agacgggcggggctggagctgcccctccgccagccctcgagcgcctgcacggacagggac
ggcccccgcccgggccaggcacgtggggacggggcaccgcagtcgctgtgcctcacgacg
cccaccgaggaggccgtgtactgcttctacgacaacgactccgatgaagagccgtccgag
gcggtggcgcccccgcggcgggcgtccgccatcccccgtgccgtgaagagagagcacccg
gccggcaggaaggacgcgcaggccacacccaaggccgcggccaaggccctgcccgctgcc
cgcgcccagcccagcctcatcgccgacgagaccccaccatgctattccctgagctcctcc
gccagctccctcagcgagcctgagccccctgagcagccggccagccggccccgtgctccc
gagccggccgtcgccaaagtcgtgggccccgggggcgggtgcagcggcgcccccggcccg
cgggcggggacggggccggggccggggccgctccggcgctgtgtcgggtcagccgtgccc
gggcgccggctccaggcgtcaggcccgcggcgccgcaagccccaggctgcccggccagac
aagcggccagcggagcggccccaggagcgcggtgacgaggcggcgggctcagaccaggcc
tccgacctggacagcgtcgagtggcgcgccatccaagagggcgccaactccatcgtcacg
tggctgcaccaggcggcggccgcggccacccacgaggcctcatctggctctgactccatc
ctgtcggaatccgggctgtcaggctccaccctgcagccgccggtgcacaggaagggacag
cggctgcaggcgggcggtgccgcgaggccgaggccggagaagcgggactcaaccctggcc
cagcacggccccagtggccccgagaagctgcgtggtgctcagaagatggcgtgcagggtg
ccggccgtgctccggggacggaccgtgatctatgtgcccagcccggccccccgggcacag
cccagaggcaaccccggcacccgtgtggcaccgaggaaggtgggagcccctgcgcagccc
gcagccccggccaaagcccccagccccgggcagcagcagcagcagcagcagcagcagcgg
tctcgaagcctacaccggccgggcaagatctcggagctggcggcactgagccccccccag
cggagcgccacgccgcccgcccgcctggccaaggccccctcgtccggctcctccccggcc
tccccggcctcccagcccccgcccaggaggccgccctcgggcccccaggctgcggggccc
ctacctggccccggggcgtctctggcgccccagacgcccgcgcgggccctactgtccaag
cagcacaagacgcagaagtcacccgtgcggatccccttcatgcagaggcccgccaggcgg
gggccgccagccctggcccgggcagccccagagccgggccccaggggccgggcaggagcc
gagggaagcctgggtgcccgagggggccgcctgggcctggtgcgcgtggcctccgcccgc
tccagtggcagcgagtcctccgaccgctcgggtttccggcggcagctgaccttcgtcaag
gagtccgcgggcctgccgcgccgccgccgctcagaggtggccgcgcccgaggccgcgacc
tccgcctcccagggcggctccccccggcgcggtcggcccgccctgcccgccgtcttcctg
tgctcctcgcgctgcgacgagctgcgggcggccccccgacgaccccctgcagccaggccc
agccccggcgagcggccggcgcggcgccccagctccgaaagcccgtcccgcctgcccgtc
cgcacgccggccgcccggcccgaggccgtcaagcgctacgcctccctgccgcacatcggc
gcgctgccggggcccgcggccgacgccgcccgccgcagcagcgacggggaggcccggccg
ctcccgagggtggcggccccgggcaccacgtggcgtcgcatccgggacgaggacgttcca
cacatccttcggagcacgctgcccgccaccgccctgcccctggtgggcgcctcccccgag
gagggccccggcgagcccccgcagcgcaagaccagcgacgccgtggtccagaccgaggac
ttcgttgccgccaagaccaactccagcacgtctccgagcctggagagcagggggcccccc
caggccctgggtggcggccccacatccttccctggcagcgatgtggatgggccctgcccc
cccaaggcgcccacctctgcccccttcgtccatgagggcctgggggtggccgtgggaggc
tttcccaccagccggcacggctcccccagccgcgcggcccgcgtgccccccttcaactat
gtgcccagccccatggtggcagccgccgccgacttggccgcagagaaagcccccgccgct
gcccccgccagccttctggaatag

DBGET integrated database retrieval system