KEGG   Acinonyx jubatus (cheetah): 106973568
Entry
106973568         CDS       T04657                                 

Gene name
BBC3
Definition
(RefSeq) bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04390  Hippo signaling pathway
aju05016  Huntington disease
aju05162  Measles
aju05200  Pathways in cancer
aju05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    106973568 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106973568 (BBC3)
   04215 Apoptosis - multiple species
    106973568 (BBC3)
   04115 p53 signaling pathway
    106973568 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106973568 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106973568 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    106973568 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    106973568 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106973568 (BBC3)
SSDB
Motif
Pfam: PUMA Hepatitis_core
Other DBs
NCBI-GeneID: 106973568
NCBI-ProteinID: XP_026893711
UniProt: A0A6J1XMF7
LinkDB
Position
Unknown
AA seq 193 aa
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLC
APTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPT
QAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLP
LPRARGAPEMEPN
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcccgagcacgccaggagggcagctccccggagcccgtagagggcctggcccgcgac
ggcccgcgcccctttcccctcagccgcctggtgccctcggccgtgtcctgcggcctctgc
gagcccggcctgcccgccgcccccgccgcccccgccctgctgcccgccgcctacctctgc
gcccccaccgccccgcccgccgtcaccgccgccctggggggcccccgctggcctgggggt
ccccgcagccggccccgaggtccgcgccccgacggtcctcagccctcactctcgccggca
gagcagcacctggaatcgccggtgcccagcgccccgggggccctggcgggcggccccacc
caggcagccccgggagtccggggggaggaggagcagtgggcccgggagatcggggcccag
ctgcggcggatggcggacgacctcaacgcgctgtacgagcggcggagacaagaggagcag
cagcgacaccgcccctcaccctggagggtcctgtacaatctcatcatgggactcctgccc
ttacccagggcccgcggggccccggagatggagcccaattag

DBGET integrated database retrieval system