KEGG   Acinonyx jubatus (cheetah): 106973746
Entry
106973746         CDS       T04657                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju05010  Alzheimer disease
aju05012  Parkinson disease
aju05014  Amyotrophic lateral sclerosis
aju05016  Huntington disease
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05134  Legionellosis
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05164  Influenza A
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106973746 (APAF1)
   04215 Apoptosis - multiple species
    106973746 (APAF1)
   04115 p53 signaling pathway
    106973746 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106973746 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    106973746 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106973746 (APAF1)
   05012 Parkinson disease
    106973746 (APAF1)
   05014 Amyotrophic lateral sclerosis
    106973746 (APAF1)
   05016 Huntington disease
    106973746 (APAF1)
   05020 Prion disease
    106973746 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    106973746 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    106973746 (APAF1)
   05152 Tuberculosis
    106973746 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    106973746 (APAF1)
   05160 Hepatitis C
    106973746 (APAF1)
   05164 Influenza A
    106973746 (APAF1)
   05162 Measles
    106973746 (APAF1)
   05168 Herpes simplex virus 1 infection
    106973746 (APAF1)
   05169 Epstein-Barr virus infection
    106973746 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106973746 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Utp8 AAA_16 Hira BBS2_Mid NACHT AAA_22
Other DBs
NCBI-GeneID: 106973746
NCBI-ProteinID: XP_026926831
UniProt: A0A6J2AA77
LinkDB
Position
Unknown
AA seq 1250 aa
MDAKARNCLLQHREALEKDIKTSYIMDRMINDGVLTVSEEEKVKNEPTQQQRAALLIKMI
LKKDNYSYISFYNALIHEGYKDLAGLLHGGIPVISSSNGGKDSVGGITSYVRTVLCEGGV
PQRPVVFVTRKKLVNSIQQNLFKLNGEPGWVIIYGMAGCGKSVLAAETVRDHSFLDGCFP
GGVHWVSVGKQDKSGLLMKLQNLCARLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSL
LILDDVWDPWVLKAFDNQCQILITTRDKSVTDSVMGPKYVVSVESGLGKEKGLEILSLFV
NVKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIRKSSFY
DYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFV
NKSLLFCDRNGKSFCYYLHDLQVDFLIEKNRNQLQDLHKKLITQFQRHHQPHTLSPDQED
CMYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCA
VCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWIN
KKNNKNLSRLVVRPHTDAVYHACFSEDGQRIASCGVDKTLQVFKAETGEKLLEIKAHEDE
VLCCAFSADDRFIATCSVDKKVKIWNSMTGELVHVYDEHSEQVNCCHFTNNGHHLLLATA
SSDCFLKLWDLTQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVKSANERE
SINVKQFFLNLEEPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHASGLLAEIHTGH
HSTIQYCDFSPQNRLAVVALSQCCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLT
SSDDQTIRLWETKKVCENSAIVLKQDIDVVFQENEVMVLAVDNVRHLQLINGKTGQTDYL
TEAQVSCCCLSPHLEYIAFGGEDGAIEILELLNNRIFQSRIGHKKTVRHIQFTDDEKTLI
SSSDDSSIQVWNWQSEEYVFLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWSIITGRIEK
DFVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFELLSPLHELRGHKGCVRCSAFSVDS
TLLATGDDNGEIRIWNVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDSKMLVSAGGY
LKWWSVDTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQMLE
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaactgtttgcttcaacatagagaagccctggaaaaggacatt
aaaacgtcctacatcatggatcgtatgattaatgatggagttttaacagtatcagaggag
gaaaaagtaaaaaatgagcccactcagcagcaacgagcagctctcctaattaaaatgata
cttaaaaaagataattattcctacatatcattctacaatgctctaatacatgaagggtat
aaagatcttgctggccttcttcatggtggcattcctgtcatctcttcttcgaatggtggc
aaagattcagttggtggaataacttcatatgtaaggactgtcctgtgtgaaggtggagtg
ccacagaggccggtggtctttgttactaggaagaaactggtgaactcaattcagcagaac
ctcttcaaactaaatggtgaaccaggatgggtcatcatatacggaatggcaggttgtggg
aagtctgttttagctgcagaaactgttcgagatcattctttcttagatggttgtttccca
gggggtgtgcactgggtttcagttgggaaacaagacaagtctgggcttctgatgaaactg
cagaatctttgcgcacggttggatcaggatgagagtttctcccagaggcttccactcaat
attgaagaggctaaagaccgccttcgcattctgatgctgcgtaaacacccacggtctctg
ttgatcttggatgatgtttgggatccttgggtattaaaagcttttgacaatcagtgtcag
attcttattacaaccagagacaagagtgttacagattcagtaatgggtcctaaatatgta
gtctctgtggagagtggcttaggaaaagaaaaaggacttgaaattttatccctttttgtt
aatgtgaagaaagcagatttgccagaacaagctcacagtattataaaagaatgtaaaggt
tctcctcttgtagtgtctttgattggtgcacttttacgtgattttcccaaccgttgggat
tactaccttaggcaacttcagaataagcaatttaagagaataaggaaatcttcattttat
gattatgaggctctggatgaagccatgtctataagtgttgaaatgctcagagaggacatc
aaagattattatacagatctttccatccttcagaaggatgttaaggtgcctacaaaggtg
ttatgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtt
aataagtctctcttattctgtgatcggaatggaaaatcattttgttattatttacatgat
cttcaagtagatttccttatagaaaagaatcgcaaccagcttcaggatctacataagaag
ttaatcactcagttccagagacatcaccagccacatactctttcaccagatcaggaggac
tgcatgtattggtacaattttctggcttaccacatggctagtgctaacatgcacaaagaa
ctttgtgctttaatgttttccctggattggattaaagcaaaaactgaactcgtaggccct
gcccatctgattcatgagtttgtggaatataggcatatattggatgaaaaggattgtgca
gtctgtgaaaatttccaagagtttttatcattaaatggacaccttcttggacgacagcca
tttcctaatattgttcaactgggtctctgtgaaccagaaacttcagaagtttatcagcaa
gctaagctgcaggccaagcaggaggtcgataatggaatgctttacctggagtggataaac
aaaaaaaacaacaagaatctttcccgcttagttgtccgcccccatacagatgctgtttac
catgcttgcttttctgaggatggtcaaagaatagcttcttgtggagttgataaaacctta
caggtgttcaaagctgaaacaggagagaaacttctggaaatcaaggctcatgaggatgaa
gtgctttgttgtgcattctctgcagatgacagattcatagcaacctgctcagtggataaa
aaagtgaagatttggaattctatgactggggaactagtacatgtctatgatgagcactca
gagcaagtcaactgctgccactttaccaacaacggtcatcaccttctcttagccactgca
tcaagtgactgtttcctcaaactgtgggatttgacccaaaaagagtgtcggaataccatg
tttggccacacaaattcagtcaatcactgcagattttcaccagatgataagcttttggct
agttgttcagctgatggaacattaaagctttgggatgtgaaatcagcaaacgagagggaa
agcattaatgtgaagcaattcttcctaaatttagaggagcctcaagaggatatggaggtg
atagtgaaatgttgttcatggtctgctgatggtgctaggataatggtggcagcaaaaaat
aagatctttctttttgacattcatgccagtggcctgttggcagaaatccatacaggccat
catagcaccatccagtactgtgacttctccccacaaaatcgtttggcagtggtggctttg
tcccagtgctgtgtagagttgtggaacatggactcgtgtttaaaagtggctgactgcaga
ggacatttaagttgggttcattgtgtgatgttttctcctgatggatcatcatttttgaca
tcttctgatgaccagacaatcaggctctgggagacaaagaaagtatgtgagaactctgct
atagtgttaaagcaagacatagatgttgtgtttcaagaaaatgaagtgatggttcttgca
gttgacaatgtaagacatctgcagctcattaatggaaaaacaggtcagactgattacctg
acagaagctcaagttagttgctgttgcttaagtccacatcttgagtacattgcatttgga
ggcgaagatggagccattgagattttagaactcctaaacaacagaatcttccaatccagg
attgggcacaagaaaactgtacggcacatccagttcacagatgatgagaaaactcttatt
tcaagctctgatgattcttcaattcaggtgtggaattggcaatcagaggaatatgtcttt
ctacaagcccatcaggaaacagtgaaagactttaggctcttgaaaaattcaagactgctt
tcctggtcatttgatggaacagtgaaggtgtggagtattattactggaagaatagaaaaa
gattttgtctgtcaccaagatacagtactttcttgtgatatttctcctgatgctactaaa
ttttcatctacatctgctgacaagactgcaaagatttggagttttgaacttctttcccct
cttcatgagctgaggggccacaaaggctgtgtgcgctgctctgccttctctgtggacagt
accctgttggcgactggagatgacaatggagaaatcaggatatggaatgtctcaaatggt
gagctgcttcatttatgcgctccgatttcagtagaggaaggagctgctacccatggaggc
tgggtgactgacctttgcttttcaccagatagcaaaatgcttgtctctgctggaggatat
cttaagtggtggagtgttgacactggggaatcctcacagaccttctacacaaatggaacc
aatcttaagaaaatacacgtgtctcctgacttcaaaacatatgtgactgttgataatctt
ggtattttatatattttacagatgttagagtaa

DBGET integrated database retrieval system