KEGG   Acinonyx jubatus (cheetah): 106974119
Entry
106974119         CDS       T04657                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05132  Salmonella infection
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05221  Acute myeloid leukemia
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106974119 (TCF7L2)
   04390 Hippo signaling pathway
    106974119 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106974119 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106974119 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106974119 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106974119 (TCF7L2)
   05225 Hepatocellular carcinoma
    106974119 (TCF7L2)
   05226 Gastric cancer
    106974119 (TCF7L2)
   05216 Thyroid cancer
    106974119 (TCF7L2)
   05221 Acute myeloid leukemia
    106974119 (TCF7L2)
   05217 Basal cell carcinoma
    106974119 (TCF7L2)
   05215 Prostate cancer
    106974119 (TCF7L2)
   05213 Endometrial cancer
    106974119 (TCF7L2)
   05224 Breast cancer
    106974119 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106974119 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106974119 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106974119 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    106974119 (TCF7L2)
   05165 Human papillomavirus infection
    106974119 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106974119 (TCF7L2)
Transcription factors [BR:aju03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    106974119 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 106974119
NCBI-ProteinID: XP_026918870
UniProt: A0A6J1ZRS0
LinkDB
Position
Unknown
AA seq 678 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVQCPLPCCTQGHDCQHLYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCLESNKVPVVQ
HPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQ
IPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTT
GIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK
KRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCV
RYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLP
MMPPPPALLLAEAAHGKAPALCPNGALDLPPAALQPPVLSASSLAQPSTSSLHSHSAVAV
AVAGTQPQPLSLVTKSLE
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtctgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatctccagatgaaatggccactgcttgat
gtccaggcggggaccctccagagcagacaagccctcaaggatgcccgctctccgtcaccg
gcacacattgtccagtgccccctcccttgctgcactcagggacatgactgtcagcacctc
taccccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccac
tccctacaaaaggttggggagccctggtgtttggagtcgaacaaagtaccggttgtgcaa
caccctcaccatgtccaccctctcacgccgctcatcacgtacagcaacgaacacttcacc
ccgggaaacccacctccacacttaccagccgacgtagaccccaaaacaggaatcccacgg
cctccgcaccctccagatatatctccgtattacccactatcgcccggcaccgtaggacaa
atcccccatccgctaggatggttagtaccacagcaaggtcagcccgtgtacccaatcacg
acaggaggattccgtcacccctaccccacagctctgactgtcaacgcctccatgtctagc
ttcctgtcttccaggttccctccccatatggtcccaccacatcacactctacacacgacc
ggcatcccccacccggccatagtaacgccaaccgtcaaacaggaatcctcccagagtgac
gtcggctcactccatagctcaaagcatcaggactccaaaaaggaagaagaaaagaagaag
ccccacataaagaaacctcttaacgcgttcatgttgtatatgaaggaaatgagggccaag
gtcgtggccgagtgcacgttgaaagaaagtgccgccatcaaccagatcctggggcgaagg
tggcatgcgctgtccagagaagagcaagcgaaatactacgagctggcccggaaggagcga
cagcttcacatgcagctgtaccccggctggtctgcgcgggataactatgggaagaagaag
aagaggaaaagggacaagcagccaggagagaccaatgaacacagcgaatgtttcctaaat
ccttgcctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgc
tttggccttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgtt
cgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagatggaagcttacta
gactcgcctcctccctcccccaacctgctaggctcccctccccaagacgccaagtcacag
actgagcagacccagcctctctcgctgtccctgaagcccgaccccctggcccacctgccc
atgatgccgccgccgcccgccctcctgcttgccgaggccgcccacggcaaggcccccgcc
ctctgtcccaacggggccctggacctgccccccgccgccctgcagccgcccgtcctgtct
gcctcgtctctggcgcagccgtcgacatcttccttacattcccacagcgccgtggccgtg
gccgtggccgggacgcagccccagccgctgtccctcgtgaccaagtctttagaatag

KEGG   Acinonyx jubatus (cheetah): 106978197
Entry
106978197         CDS       T04657                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05132  Salmonella infection
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05221  Acute myeloid leukemia
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106978197 (TCF7L1)
   04390 Hippo signaling pathway
    106978197 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106978197 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106978197 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106978197 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106978197 (TCF7L1)
   05225 Hepatocellular carcinoma
    106978197 (TCF7L1)
   05226 Gastric cancer
    106978197 (TCF7L1)
   05216 Thyroid cancer
    106978197 (TCF7L1)
   05221 Acute myeloid leukemia
    106978197 (TCF7L1)
   05217 Basal cell carcinoma
    106978197 (TCF7L1)
   05215 Prostate cancer
    106978197 (TCF7L1)
   05213 Endometrial cancer
    106978197 (TCF7L1)
   05224 Breast cancer
    106978197 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106978197 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106978197 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106978197 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    106978197 (TCF7L1)
   05165 Human papillomavirus infection
    106978197 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106978197 (TCF7L1)
Transcription factors [BR:aju03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    106978197 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 106978197
NCBI-ProteinID: XP_026927848
UniProt: A0A6J2AEG4
LinkDB
Position
Unknown
AA seq 620 aa
MPSSCGGGGGGSGAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSL
VNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGYPFLMIPD
LSSPYLSNGPLSPGGARTITDLSSGASYKSYRPQCSQVSARSSYSTMSNLNWLPLEPQYL
QMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQPPHHMHPLTPLITYSNDHFSPGSPPT
HLSPEIDPKTAGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFR
HPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAV
SAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLS
REEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALA
SKSKKPCVQYLPPEKSCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTK
PESRAQLALHSAAFLSAKATATSSGQMGSQPPLLSRPLPLGSLPTALLTSPPSFPTTLHA
HQALPVLQAQPLSLVTKSAH
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgcccagcagctgcggcggcggcggcggcggctcgggcgccggggcggccggcggaggg
gacgacctcggggcgaacgacgagctgatccccttccaagacgaggggggcgaggagcag
gagccgagcagcgacagtgcctcggcgcagcgggacctggacgaggtcaagtcgtccctg
gtcaacgagtcggagaaccagagcagcagctcggactcggaggcggagaggcgcccgcag
cccgcccgggacgccttccagaagccgcgggactatttcgccgaagtgagaaggccccag
gacggcgcgttctttaagggtcccccgtaccctgggtacccgttcctgatgatcccggac
ttgagcagtccgtacctctccaacggacccctgtccccgggaggagcgcgcacgattaca
gacctctcgagtggagcctcctacaagtcttacagacctcaatgcagccaagtgtcagca
cgcagtagttattcaacaatgagtaacttgaattggcttccacttgaacctcagtaccta
cagatgaaatggcccctcctcgatgtcccatccagtgccacagtcaaagacaccaggtca
ccatccccggcacacttgtctaataaagttcctgttgttcagcccccgcatcacatgcac
ccgttgacgcccctcatcacctacagcaacgaccacttctcccctggctcccctcccaca
catctctccccagagattgatccaaagacagcaggaatcccccggccccctcacccatct
gagctgtctccatattacccactgtctcctggagctgtcggacaaatccctcatcctctc
ggctggctcgtcccgcagcaaggacagcccatgtactcccttcctcctggtggcttccgg
cacccctaccctgccctcgccatgaacgcctcaatgtccagcctggtttccagtcggttc
tctcctcacatggtggctccggcccatcctggtctgcccacctcagggattccccacccc
gccatcgtctcccccattgtcaagcaggagccagcaccccccagcctgagccccgccgtg
agcgcgaaatcaccagtcacggtgaaaaaggaagaagaaaagaaaccccacgtgaagaag
cctcttaatgccttcatgttatatatgaaggagatgagggccaaggtggtggccgagtgc
accctgaaggagagcgcggccattaaccaaatcctgggaagaaagtggcacaacttgtcc
cgagaagaacaggccaagtactatgaactggcccggaaggagcggcaacttcactcccag
ctctacccgacctggtcagcccgggacaactatggtaagaaaaagaagaggaagagagaa
aagcagctgtcacagacacagtcccagcagcaagtccaagaggcagagggtgctctggcc
tccaagagcaagaagccatgtgttcagtacctgccccccgagaagtcgtgtgacagccct
gcctcttcccacggcagcatgctcgactccccggccaccccctccgcggccttggcgtcg
cctgctgcccctgctgcaacccactcggagcaagcccagcccctctccctcaccaccaag
ccggagagccgggcccagctggctctacactcggccgccttcctgtccgctaaggcgaca
gccacctcctctggccagatgggcagccagcccccactcctctcccggcccctccccctc
gggtccctgcccacagctctgctgacttcccccccctccttccccaccacgctccatgcc
caccaggccctcccggtcctccaggcccagcctctttccttggttaccaagtctgcccac
tga

KEGG   Acinonyx jubatus (cheetah): 106983664
Entry
106983664         CDS       T04657                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X3
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05132  Salmonella infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05221  Acute myeloid leukemia
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106983664 (LEF1)
   04390 Hippo signaling pathway
    106983664 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106983664 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106983664 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106983664 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106983664 (LEF1)
   05225 Hepatocellular carcinoma
    106983664 (LEF1)
   05226 Gastric cancer
    106983664 (LEF1)
   05216 Thyroid cancer
    106983664 (LEF1)
   05221 Acute myeloid leukemia
    106983664 (LEF1)
   05217 Basal cell carcinoma
    106983664 (LEF1)
   05215 Prostate cancer
    106983664 (LEF1)
   05213 Endometrial cancer
    106983664 (LEF1)
   05224 Breast cancer
    106983664 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106983664 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106983664 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106983664 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    106983664 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106983664 (LEF1)
Transcription factors [BR:aju03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    106983664 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 106983664
NCBI-ProteinID: XP_014937350
UniProt: A0A6J0A4M0
LinkDB
Position
Unknown
AA seq 400 aa
MPQLSGAGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVN
ESEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPN
MNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHLPSDVN
SKQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSM
SRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHI
KKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLH
MQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggccggcggcggcggcggcgggggagacccggaactctgcgcc
accgacgagatgatccccttcaaggatgagggcgatcctcagaaggagaaaatcttcgcc
gagatcagtcaccccgaagaggaaggcgacttagccgacatcaagtcctccttggttaat
gagtctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctct
caggagtcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatgga
ggcctctacaacaagggaccctcctactcaagttattccgggtacataatgatgccaaat
atgaataatgacccatacatgtcaaatggatctctttctccacccatcccaagaacatca
aataaggtgcctgtggtgcagccatcacacgcggtccatcctctcaccccccttatcacg
tacagcgacgagcacttttctccaggatcacacccctcacacctcccttcagatgtcaac
tccaaacaaggcatgtccagacatcctccagctcctgagatccctaccttttatcctctg
tctccaggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatat
cccatcacgggaggattcaggcaaccctacccatcctcactgtcagtcgacacttccatg
tccaggttttcccatcatatgattcctggtcctcctggtccccacacaactggcatccct
catccagctatcgtaacgcctcaggtcaaacaggaacatccccacactgacagtgaccta
atgcacgtgaagcctcagcatgaacagagaaaggaacaggagccaaaaagacctcacatt
aagaagcctctgaacgcttttatgttatacatgaaagaaatgagagcgaatgttgtagct
gagtgtactctaaaagaaagtgcagctatcaaccagattctgggcagaaggtggcatgcc
ctctcccgtgaagagcaggctaaatattatgaattagcacggaaggaaagacagctacat
atgcagctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaag
agagagaaactccaggagtcgacatcaggtacaggtcccagaatgacagctgcctacatc
tga

KEGG   Acinonyx jubatus (cheetah): 106984911
Entry
106984911         CDS       T04657                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04916  Melanogenesis
aju04934  Cushing syndrome
aju05132  Salmonella infection
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05221  Acute myeloid leukemia
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106984911 (TCF7)
   04390 Hippo signaling pathway
    106984911 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106984911 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    106984911 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106984911 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106984911 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106984911 (TCF7)
   05225 Hepatocellular carcinoma
    106984911 (TCF7)
   05226 Gastric cancer
    106984911 (TCF7)
   05216 Thyroid cancer
    106984911 (TCF7)
   05221 Acute myeloid leukemia
    106984911 (TCF7)
   05217 Basal cell carcinoma
    106984911 (TCF7)
   05215 Prostate cancer
    106984911 (TCF7)
   05213 Endometrial cancer
    106984911 (TCF7)
   05224 Breast cancer
    106984911 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106984911 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106984911 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106984911 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    106984911 (TCF7)
   05165 Human papillomavirus infection
    106984911 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106984911 (TCF7)
Transcription factors [BR:aju03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    106984911 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 106984911
NCBI-ProteinID: XP_026932486
UniProt: A0A6J2ARJ2
LinkDB
Position
Unknown
AA seq 567 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGVPGAGAGARGEAEVGAEALGREHASQRLFPDKLPESLEDGLKAPECASGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPPLHNKASQPAHSVPQLSPLYEHFSSPHPTPAPAD
ISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAA
PGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPYDRSLKTQAESKAEKEAK
KPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKE
RQLHMQLYPGWSARDNYGKKKRRSREKHQESNTDPGSPKKCRARFGLNQQTDWCGPCRRK
KKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYLLLPHFPTELLASPAEPAPTSP
GLSAALSLPAPWTPTGPPQRPAEYTAATTGISETGSLACTGHLAASRGSSSERKRQSPKA
RGNWPGALLPPSQGPGPGDFRGCTTSA
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcggcgcgggcgggggcgacgacctcggcgcgccg
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacagc
gccgcgggccccgagcgcgacctggccgagctcaagtcgtccctggtcaatgagtccgag
ggcgcggcgggcggcgcgggggtccctggggccggtgccggggcccgcggcgaggcggag
gtcggggccgaggctctcgggcgggaacacgcttcgcagagacttttccccgacaaactt
ccagagtctctggaagacggcctgaaggccccggagtgcgccagcggcatgtacaaagac
accgtctactcggccttcaatctgcttatgcactacccacccccttcgggagcagggcag
cacccccagccgcagcccccactgcacaacaaggccagtcagccagcccacagcgtccca
cagctctctcctctctatgaacatttcagcagcccacaccctacacctgcaccagccgac
atcagccagaagcaaggagttcacaggcctctgcagacccctgacctctctggcttctac
tctctgacctcaggcagcatgggacagcttccccacactgtgagctggcccagccctcct
ctctaccccctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcc
cctggcgccccctaccccaggttcacccacccatccctgatgctaggctccggtgtgcct
ggtcaccctgcagccatcccccacccggctatcgtacctccctcaggcaagcaggagctg
cagccatatgaccgtagcctgaagacacaggcggaatccaaggcagagaaagaggccaag
aagccaaccatcaagaagccactcaatgccttcatgctgtacatgaaggagatgagagcc
aaggtcattgcagagtgtacactcaaggagagtgctgccatcaaccagatcctgggccgc
aggtggcacgcgctgtctcgggaagagcaggccaagtattatgagctggcccgaaaagag
aggcagctgcacatgcagctctacccaggctggtcggcgcgggacaactatgggaagaaa
aagaggcggtcaagagaaaagcaccaggagtccaacacagaccctggctcgcctaagaaa
tgccgtgctcgctttggcctcaaccagcagacggattggtgtggtccgtgcaggaggaaa
aagaaatgcattcggtatttacccggagaaggccgctgccccagcccagttccttccgat
gacagtgctctaggctgccccgggtccccagccccccaggactcgccctcatacctcctg
ctaccccactttcccacagaactgcttgctagccctgcggagccggcgcctacatcacca
ggtctctcggccgctctcagcctcccagccccctggaccccaacaggccccccacagcgt
cctgcagagtacacagctgcaacgacaggaatctcagagacaggcagcctagcatgtaca
ggacacctggccgcctccaggggctcatcctctgagaggaagcgacagagccccaaagca
cgtgggaactggccaggggccctgttacctccctctcagggaccgggcccaggagacttc
cgaggctgcacaacttctgcctga

DBGET integrated database retrieval system