KEGG   Acinonyx jubatus (cheetah): 106974351
Entry
106974351         CDS       T04657                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 proprotein isoform X1
  KO
K13377  transforming growth factor beta-3
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04060  Cytokine-cytokine receptor interaction
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04218  Cellular senescence
aju04350  TGF-beta signaling pathway
aju04390  Hippo signaling pathway
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05140  Leishmaniasis
aju05142  Chagas disease
aju05144  Malaria
aju05145  Toxoplasmosis
aju05146  Amoebiasis
aju05152  Tuberculosis
aju05161  Hepatitis B
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05211  Renal cell carcinoma
aju05212  Pancreatic cancer
aju05220  Chronic myeloid leukemia
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05321  Inflammatory bowel disease
aju05323  Rheumatoid arthritis
aju05410  Hypertrophic cardiomyopathy
aju05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106974351 (TGFB3)
   04350 TGF-beta signaling pathway
    106974351 (TGFB3)
   04390 Hippo signaling pathway
    106974351 (TGFB3)
   04068 FoxO signaling pathway
    106974351 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106974351 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106974351 (TGFB3)
   04218 Cellular senescence
    106974351 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106974351 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106974351 (TGFB3)
   05212 Pancreatic cancer
    106974351 (TGFB3)
   05225 Hepatocellular carcinoma
    106974351 (TGFB3)
   05226 Gastric cancer
    106974351 (TGFB3)
   05220 Chronic myeloid leukemia
    106974351 (TGFB3)
   05211 Renal cell carcinoma
    106974351 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    106974351 (TGFB3)
   05321 Inflammatory bowel disease
    106974351 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    106974351 (TGFB3)
   05414 Dilated cardiomyopathy
    106974351 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106974351 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106974351 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106974351 (TGFB3)
   05161 Hepatitis B
    106974351 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106974351 (TGFB3)
   05144 Malaria
    106974351 (TGFB3)
   05145 Toxoplasmosis
    106974351 (TGFB3)
   05140 Leishmaniasis
    106974351 (TGFB3)
   05142 Chagas disease
    106974351 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aju04052]
    106974351 (TGFB3)
Cytokines and growth factors [BR:aju04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   106974351 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 106974351
NCBI-ProteinID: XP_014927046
UniProt: A0A6I9ZSX2
LinkDB
Position
Unknown
AA seq 412 aa
MKMHLHRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRSEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcacagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggactttggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagtccccccgagccatcg
gtgatgacccacgtcccctaccaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcagggggagagggaggacagctgcactcaggaaaacaccgagtcggagtac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaatgagctg
gccgtctgccccaaagggatcacctccaaggtcttccgcttcaacgtgtcctcagtggag
aaaaatggaaccaacctgttccgagcggaattccgggtcttgcgggtgcccaaccccagc
tctaagcgcagtgagcagaggatcgagctcttccagatactccggcccgatgagcacatc
gccaaacagcgctatatcggtggcaaaaatctgcccacacggggcactgccgaatggctg
tctttcgacgtcactgacaccgtgcgggaatggctcttgcgaagagagtccaacttaggt
ctggaaatcagcattcactgtccgtgtcacacctttcagcccaatggagacatcttggaa
aacattcatgaggtgatggaaatcaaattcaaaggtgtggacagtgaggatgatcatggc
cgtggggatctcgggcgcctcaagaagcagaaggaccaccacaaccctcacctcatcctc
atgatgattcccccgcaccggctggacaacccgggccagggcgggcagaggaagaagcgg
gccctggacaccaactactgcttccgcaatttggaggagaactgctgtgtgcgccctctc
tacattgacttccgacaagatctgggctggaagtgggtccacgaacctaagggctactat
gccaacttctgctcaggcccctgcccctacctccgcagtgcggacaccacccacagcacg
gtgctgggactgtacaacaccctgaatcccgaagcctctgcctcaccttgctgtgtgccc
caggacttggagcccctgaccatcctgtactatgtcgggaggacccccaaggtggaacag
ctctctaacatggtggtcaagtcctgtaagtgtagctga

KEGG   Acinonyx jubatus (cheetah): 106979500
Entry
106979500         CDS       T04657                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04060  Cytokine-cytokine receptor interaction
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04218  Cellular senescence
aju04350  TGF-beta signaling pathway
aju04380  Osteoclast differentiation
aju04390  Hippo signaling pathway
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05140  Leishmaniasis
aju05142  Chagas disease
aju05144  Malaria
aju05145  Toxoplasmosis
aju05146  Amoebiasis
aju05152  Tuberculosis
aju05161  Hepatitis B
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05210  Colorectal cancer
aju05211  Renal cell carcinoma
aju05212  Pancreatic cancer
aju05220  Chronic myeloid leukemia
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05321  Inflammatory bowel disease
aju05323  Rheumatoid arthritis
aju05410  Hypertrophic cardiomyopathy
aju05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106979500 (TGFB2)
   04350 TGF-beta signaling pathway
    106979500 (TGFB2)
   04390 Hippo signaling pathway
    106979500 (TGFB2)
   04068 FoxO signaling pathway
    106979500 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106979500 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106979500 (TGFB2)
   04218 Cellular senescence
    106979500 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106979500 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106979500 (TGFB2)
   05206 MicroRNAs in cancer
    106979500 (TGFB2)
   05205 Proteoglycans in cancer
    106979500 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106979500 (TGFB2)
   05212 Pancreatic cancer
    106979500 (TGFB2)
   05225 Hepatocellular carcinoma
    106979500 (TGFB2)
   05226 Gastric cancer
    106979500 (TGFB2)
   05220 Chronic myeloid leukemia
    106979500 (TGFB2)
   05211 Renal cell carcinoma
    106979500 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    106979500 (TGFB2)
   05321 Inflammatory bowel disease
    106979500 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    106979500 (TGFB2)
   05414 Dilated cardiomyopathy
    106979500 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106979500 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106979500 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106979500 (TGFB2)
   05161 Hepatitis B
    106979500 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106979500 (TGFB2)
   05144 Malaria
    106979500 (TGFB2)
   05145 Toxoplasmosis
    106979500 (TGFB2)
   05140 Leishmaniasis
    106979500 (TGFB2)
   05142 Chagas disease
    106979500 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aju04052]
    106979500 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106979500 (TGFB2)
Cytokines and growth factors [BR:aju04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   106979500 (TGFB2)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   106979500 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 106979500
NCBI-ProteinID: XP_014932862
UniProt: A0A6I9ZZF6
LinkDB
Position
Unknown
AA seq 442 aa
MHYCVLSAFLLLHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRHSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgctcctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactatcccgagccc
gaggaagtccccccggaggtgatttccatctacaacagcacccgggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgttccagacattcccaggtgctctgt
gggtaccttgatgccatcccgcccacattctacagaccttacttcagaattgtccgattt
gacgtctcagcgatggagaagaatgcatccaatttggtgaaagcggagttcagagtcttt
cgtttacagaacccgaaggccagagtgcccgaacaaaggatcgaactgtatcagattctc
aaatccaaagacttaacgtctccaacccagcgctacattgacagcaaagtcgtgaagaca
agggcagaaggcgaatggctttccttcgatgtaactgacgccgttcacgaatggctccac
cataaagacagaaacctgggatttaaaataagcttacactgtccctgctgcacctttgtg
ccatctaataattacatcattcccaataaaagtgaagagctagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtggaaagaccccacacctcctgctaatgttgttgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctttggatgcagcctattgttttagaaat
gtgcaggataattgctgcctacgtccactttatattgatttcaagagggatcttgggtgg
aaatggattcatgaacctaaagggtacaatgccaacttctgtgctggagcttgcccgtat
ttatggagttcagacactcagcacagtagggttctcagtttatataacaccataaatcca
gaagcatctgcttctccttgctgtgtgtcccaggatttagaaccgctaaccattctctac
tatatcggcaaaacacccaagattgaacagctttcaaatatgattgtaaagtcttgcaaa
tgcagctaa

KEGG   Acinonyx jubatus (cheetah): 106987682
Entry
106987682         CDS       T04657                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 proprotein isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04060  Cytokine-cytokine receptor interaction
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04218  Cellular senescence
aju04350  TGF-beta signaling pathway
aju04380  Osteoclast differentiation
aju04390  Hippo signaling pathway
aju04659  Th17 cell differentiation
aju04672  Intestinal immune network for IgA production
aju04926  Relaxin signaling pathway
aju04932  Non-alcoholic fatty liver disease
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05140  Leishmaniasis
aju05142  Chagas disease
aju05144  Malaria
aju05145  Toxoplasmosis
aju05146  Amoebiasis
aju05152  Tuberculosis
aju05161  Hepatitis B
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05210  Colorectal cancer
aju05211  Renal cell carcinoma
aju05212  Pancreatic cancer
aju05220  Chronic myeloid leukemia
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05321  Inflammatory bowel disease
aju05323  Rheumatoid arthritis
aju05410  Hypertrophic cardiomyopathy
aju05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106987682 (TGFB1)
   04350 TGF-beta signaling pathway
    106987682 (TGFB1)
   04390 Hippo signaling pathway
    106987682 (TGFB1)
   04068 FoxO signaling pathway
    106987682 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106987682 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106987682 (TGFB1)
   04218 Cellular senescence
    106987682 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    106987682 (TGFB1)
   04672 Intestinal immune network for IgA production
    106987682 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    106987682 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106987682 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106987682 (TGFB1)
   05205 Proteoglycans in cancer
    106987682 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106987682 (TGFB1)
   05212 Pancreatic cancer
    106987682 (TGFB1)
   05225 Hepatocellular carcinoma
    106987682 (TGFB1)
   05226 Gastric cancer
    106987682 (TGFB1)
   05220 Chronic myeloid leukemia
    106987682 (TGFB1)
   05211 Renal cell carcinoma
    106987682 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    106987682 (TGFB1)
   05321 Inflammatory bowel disease
    106987682 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    106987682 (TGFB1)
   05414 Dilated cardiomyopathy
    106987682 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106987682 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    106987682 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106987682 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106987682 (TGFB1)
   05161 Hepatitis B
    106987682 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106987682 (TGFB1)
   05144 Malaria
    106987682 (TGFB1)
   05145 Toxoplasmosis
    106987682 (TGFB1)
   05140 Leishmaniasis
    106987682 (TGFB1)
   05142 Chagas disease
    106987682 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aju03110]
    106987682 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aju04052]
    106987682 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106987682 (TGFB1)
Chaperones and folding catalysts [BR:aju03110]
 Intramolecular chaperones
  Others
   106987682 (TGFB1)
Cytokines and growth factors [BR:aju04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   106987682 (TGFB1)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   106987682 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 106987682
NCBI-ProteinID: XP_026893399
UniProt: A0A6J1XLU2
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENTNKI
YEKVQRTPHSIYMLFNTSELREAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNNSWR
YLSNRLLAPSDTPEWLSFDVTGVVRQWLSHGGEVEGFRLSAHCSCDSKDNTLQVDINAGF
SSSRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggttgcggctgctgccgctgctgctgccgctgctgtggctactagtg
ctgacgcctggccggccggccgccggactgtccacctgcaagaccatcgacatggaactg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggctgtgctggccctt
tacaacagtacccgcgaccgggtggcgggggagagcgccgagccggagcccgagcctgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacaccaacaaaatc
tatgagaaagtccagcgtaccccgcacagcatatatatgctctttaacacgtcggagctc
cgagaagcagtgcccgagcccgtcttgctctcccgggcagagttgcgcctgctgaggctc
aagttaaaagcggagcagcacgtggaactgtaccagaaatacagcaataattcctggcgc
tacctcagcaaccggctgctggcgcccagtgacacgccggaatggctgtcctttgatgtc
actggagtggtgcggcagtggctgagccatggaggggaagtagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactgcaagtggacatcaacgcagggttc
agttccagccgccgaggtgacctggccaccattcatggcatgaaccggccttttctgctc
ctcatggccaccccgctggagagggcccagcacctgcacagctcgcggcaccgccgagcc
ctggacaccaactactgcttcagctccacggagaagaactgctgcgtgcggcagctctat
atcgacttccgcaaggatctgggctggaagtggatccacgagcccaagggctaccacgcc
aacttctgcctagggccctgtccctacatctggagcctggacacgcagtacagcaaggtc
ctggccctgtacaaccagcacaacccgggcgcgtcggcggctccctgctgcgtgccgcag
gcgctggagcccctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system