KEGG   Acinonyx jubatus (cheetah): 106974485Help
Entry
106974485         CDS       T04657                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    106974485 (TGM2)
Enzymes [BR:aju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     106974485 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 106974485
NCBI-ProteinID: XP_014927236
LinkDB All DBs
Position
Un
AA seq 683 aa AA seqDB search
MAEELVLERCDLELEANGRDHHTADLCREKLVVRRGPAHLGLRPRPVGPPACPGPHRVCR
RPSLPTSKLTATASPLSGPAPSEEAGTRARFPLSDAVEEGAWTAVVVGQQDSALSLQLST
PPNAPIGLYRLSLEASTGYQGSSFVLGHFILLFNPWCPGDAVYLDSDEEQHEYILTQHGF
IYQGSAKFIKNIPWNFGQFEDGILDICLTLLDMNPKFLRDAGRDCSRRSSPVYVGRVVSG
MVNCNDDQGVLLGRWDNNYGDGISPMFWIGSGDILRRWKSSGCQRVKYGQCWVFAAVACT
VLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMSRPD
LQPGYEGWQALDPTPQEKSEGGWGWPSSPGGETESWRGLPHSHLAGSNPSLRGCHSPPVF
AEVNADVVDWIRQDDGSMHKSTNHSLVVGLKISTKSVGRDERQDITHTYKYPEGSPEERE
AFTRANHLNKLTDKENTGMAMRIRVSQSMSMGSDFDVFAYITNNTSEEHTCRLLLCARTV
SYNGILGPECGTKDLLSLSLAPFSEKSIPLRILYEKYCDCLTESNLIKVRGLLTEPAVNS
YLLAERDIYLENPEIKIRILGEPKQKRKLVAEVSLRNPLTTPLSDCIFTVEGAGLTEEQK
VVEIPDPVEAGEDGKVRVDLLTS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaactggttctggagagatgtgacctggagctggaggccaatggccgtgac
caccacacagccgacctgtgccgggagaagctggtggtgcggcgggggccggcgcacctc
ggcctccgacccaggcccgtgggacccccggcgtgtcccggcccccaccgggtctgccgc
cgtccctccctgcccacgtccaagctcacggccactgcttctcctctatcaggcccagcc
cccagcgaggaggccggcacccgggcccgcttcccgctgtccgatgctgtggaggaaggt
gcctggacggccgttgtggtgggccagcaggacagtgccctctcgctgcagctcagcacc
ccgcctaacgcccccatcggcctgtaccgcctcagcctggaggcctccaccggctaccag
ggctccagcttcgtgctgggccacttcatcctgctcttcaacccctggtgcccaggggat
gctgtgtacctggactcagatgaggagcagcacgagtacatcctcacccagcatggcttc
atctaccagggctcggccaagttcatcaagaacataccctggaactttgggcagtttgaa
gacgggatcctggacatttgcttgacgctcctggacatgaaccccaagttcctgagggat
gccggccgcgactgctcccgccgcagcagtcccgtctacgtgggccgggtggtgagcggc
atggtcaactgcaacgatgaccagggcgtgctgctggggcgctgggacaacaactacggg
gacggcatcagccccatgttctggatcggcagcggggacattctgcggcgctggaagagc
tccggctgccagcgtgtcaagtatggccagtgctgggtcttcgcggctgtggcctgcacg
gtgctgcggtgcctcggcatccccacccgagtggtgaccaactataactcggcccacgac
cagaacagcaacctcctcatcgagtacttccgcaacgagtttggggagatccagggtgat
aagagcgagatgatctggaacttccactgctgggtggagtcatggatgagcaggccagac
ctgcagccgggctacgaggggtggcaggccctcgaccccacgccccaggagaagagcgaa
ggtgggtgggggtggccctcttccccaggcggggaaactgagtcttggagaggactcccc
cacagtcacttggccggttctaaccccagtttgagagggtgccactccccccctgtcttt
gctgaggtcaatgccgacgtggtggactggatccggcaggacgatgggtccatgcacaag
tccaccaaccactccctggtcgtggggctgaagatcagcactaagagcgtgggccgtgac
gagcggcaggacatcacccacacctacaagtacccggaggggtccccagaggagagagag
gccttcacgagggccaaccacctgaacaagctgactgataaagagaacaccgggatggcc
atgcggatccgcgtgagccagagcatgagcatgggtagcgacttcgacgtcttcgcctac
atcaccaacaacacctcggaggagcacacctgccgcctcctgctctgtgcccgcaccgtc
agctacaacgggatcctggggcccgagtgcggcaccaaggacctgctcagcctttccctg
gcgcctttctccgagaagagcattccccttcgaatcctctacgagaaatactgtgactgc
ctgaccgagtcaaacctcatcaaggtgcggggactcctcactgagccggctgtcaacagc
tacctgctagctgagagggacatctacctggagaatccagaaatcaagatccggatcctg
ggcgagcccaagcagaaacgcaagctggtggctgaggtgtccctgcggaacccgctcacc
acgcccctgtcagactgcatcttcaccgtggagggggccggactgacggaggagcagaag
gtcgtggagatcccggaccccgtggaggcgggggaggacggcaaggtgagggtggacctg
ctgacaagctga

DBGET integrated database retrieval system