KEGG   Acinonyx jubatus (cheetah): 106974719
Entry
106974719         CDS       T04657                                 

Gene name
WDR62
Definition
(RefSeq) WD repeat-containing protein 62 isoform X1
  KO
K21762  WD repeat-containing protein 62
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106974719 (WDR62)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106974719 (WDR62)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A DUF5046 DUF844 MSL1_dimer
Other DBs
NCBI-GeneID: 106974719
NCBI-ProteinID: XP_026900477
LinkDB
Position
Unknown
AA seq 1534 aa
MAALGPGGYARNDAVEKLPSVTVGVPARRNQCSPPPAPQLCLRRRTRLSAAPEDTVHNRV
SLEKVLGITAQNSSGLTCDPSTGHVAYLAGCVVVILNPKENKQQHIFNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVDEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTEAKVTGTVPL
VGRSGILGELHNNIFCGVACGRGQMAGNTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLQYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAVYP
DTVALTFDPIHQWLSCVYKDHSIYIWDVKDINKVGKMWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNMDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQDTSHFPD
RGGENGTPVDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQQASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIVTG
MKFTYDCRHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHREQQQQNMRDGKWRSQPRQ
ETYASVPSEICSLSPGEQTEDELEEECEPEELLKTPSKESLDPDPRCLLTNGKLPLWAKR
LLGDDDVADGSAFHAKRSYKPHGRWAERADQEPLKTILDARNLDCYFTPMKPESLEDSIL
DTVEPQSLVGLLSELESPQEDGCGHPSFLPLQRESPEDRELIVYSLEAEVTVTETDSKYC
TKTTEAGPGEQQGDASLRVSSISSKDQSPPEDLGESEADLECSFATIHSSPPRPEPDPQF
DMMLPPTPGCPGTAEELSQPEVPGISNSSLPQTPEQEKFLRQHFETLTDAHSEELFHGSL
RDLEASETEDFFNPRLSISAQFLSRLQKTSRFTHTFPAQLPRHLVKSPEVKLTDPGGSQP
RAEPPRAGTGHTSPGRTNVPPGKKPEEPVEILEAWCPLTPCLTGPAPCAPSSSVLPTDRK
PSTPTALPTPGLAQGVHSPSIHSYMEATASSRAKMSRSISLEDSEGPVLAELARPLRRPS
SVGELASLGQELQANPTTAALSSNSEGREPVLPSWGNHEARASLKLTLSSICDRLLLPPS
PVEPVATQPSVTITTATFSASSPVDASTLGLHKSTFLPRLLAPEPLNTPAHPNSTPLPEA
RPGVPGSITSILETTPDALSLAQGNLGHWEEPRVPARVPPSARLDLSTVSTIVHRLQTAF
QEALDLYNVMVSRDEVSSEQQQARTELASTFVWIHSQLEASDWLVGTDVAQAQPSPRSSS
PTTLCPLASPDLHALLEHYSELLVQAVRRKARGD
NT seq 4605 nt   +upstreamnt  +downstreamnt
atggcggccttggggcccggaggctacgcgcggaacgatgcagtcgagaagctgccatcc
gtcacggtgggagttccggcgcggaggaaccagtgctctccgcctcccgctccccaactg
tgtctccggcggcggacccgactctcggcggcgccggaggacacggtgcacaaccgggtg
tcgctcgagaaggtgcttggcatcacagcccagaacagcagtggcctgacctgtgacccc
agcacaggccatgtggcctacctggcaggctgtgtggtggtgattttgaaccccaaggag
aacaagcagcagcacatttttaacactgccaggaagtcgctgagtgctctggccttctcc
cctgatgggaagtacatagtgacaggggagaacgggcacaggcctgctgtgcgcatctgg
gatgtggatgagaagaatcaggtggcagagatgctgggccacaagtacggcgtggcctgt
gtggccttctcccccaatatgaagcacatcgtgtctatgggctaccagcacgacatggta
ctcaacgtctgggactggaagaaagacattgtggtggcttccaacaaggtatcatgcagg
gtcatcgccctctctttctcagaggacagcagctattttgtcaccgtagggaatcggcat
gtgaggttctggttcttggaagtctccactgaagcaaaggtgacgggcacggtgcccctc
gtagggcgttcaggcatcctgggagagctgcacaacaacatcttctgtggcgtggcttgt
ggccggggccagatggcaggcaataccttctgtgtgtcctactcgggcctcctctgccag
ttcaatgagaagagggtgctggagaagtggatcaacctgaaggtctctctgtcttcctgc
ctgtgtgtcagccaggagctcatcttttgcggctgcacagatgggatagtccgcatcttc
caggcccacagcctgcagtacctcgcgaacctgcccaaaccgcactaccttggggtggac
gtggcccagggcttggagcccagcttcctcttccacagaaaggcagaagcagtctaccca
gatacggtggcactgaccttcgaccccatccatcagtggctgtcctgcgtgtataaggac
cacagcatctacatctgggatgtcaaagacatcaacaaagtaggcaagatgtggtcggag
ctcttccacagctcctacgtctggaacgtggaggtgtatccggagtttgaagatcagaga
gcttgtctgccatcaggatcttttcttacttgctcctcagacaacaccatccgcttttgg
aacatggatagcagccctgactctcactggcagaaaaatatcttcagtaataccctgctg
aaggtagtgtacgtagagaatgacatccagcacctgcaggacacgtcgcacttcccagac
cgggggggtgagaacgggacgcctgtggacgtgaaagctggggtgcgggtcatgcaggtc
agtcctgatggccagcacttggcttcaggcgaccgaagtggaaatctgaggatccacgag
ctacatttcatggacgagctggtcaaggtggaggcccatgatgctgaggtgctgtgcctg
gagtactccaagcctgagacaggactgaccttgctggcctcagccagtcgggaccgactg
atccacgtgctgaatgtggagaagaactacaacctggagcagaccctggacgaccactcc
tcctccatcacggccatcaagtttgctggcaatagagacatccagatgatcagctgtggg
gctgacaagagcatctactttcgcagtgcccagcaggcctcagatggactacactttgtc
cgtacccaccacgtggcagagaagaccaccttgtatgacatggacatcgacatcacccaa
aagtatgtggccgtggcctgccaggaccgcaatgtgagagtctacaacaccgtgaatggg
aagcagaagaagtgctacaagggctcccagggtgatgaagggtccctgctaaaggtccac
gtggacccctcaggcaccttcttggccactagctgctctgacaaaagcatctcggtgatt
gacttttactcgggcgagtgcattgccaagatgtttggccattcagaaattgtaactggc
atgaagttcacctatgactgtcgtcacttgatcacagtatctggagacagctgtgtgttc
atctggcacctgggcccagagatcactaactgcatgaagcagcacttgctggagatcgac
caccgggagcagcagcagcagaacatgagggacgggaagtggaggagccagcccaggcag
gagacctatgcatccgtgcccagcgagatttgctccttaagccctggagagcagacggag
gatgagctggaggaagagtgcgaaccggaagagttgttgaagacgccatccaaagagagc
ttggacccagaccctcggtgtctgctgaccaatggcaagctgccactctgggcaaagcgg
ctgctaggagacgatgatgtggcagatggctcagccttccatgccaagcgcagctacaaa
ccacatggccgctgggcggagcgggctgaccaggagcccctcaagaccatcctggatgcc
cggaacctggattgctactttacccccatgaagcccgagagcctggaggactctattctg
gatacagtggagccccagagcctggtgggactgctgagtgagttggagagtccccaggag
gatggctgtgggcatccctccttcctgcccctacagagggagtcccctgaggacagggag
ctcatcgtctactccctggaggcagaagtgacggtcacagagacagacagcaagtattgc
acgaagacgaccgaggcggggcccggagagcagcaaggagacgcctccctcagggtctcc
tccatcagctccaaggatcagagcccacctgaggacttgggggagtcagaggccgacttg
gagtgcagcttcgccaccatccattcctcccctccacggccagagccagaccctcagttt
gacatgatgctgccccccacaccaggatgcccagggaccgcagaagagctgtcccagccc
gaggtgccaggcatatccaacagctccctgccccagacccctgagcaggagaagttcctc
cgccagcacttcgagacgctcactgatgctcactctgaggagctcttccatggatccctg
agagacttggaggcctctgagactgaggacttcttcaatccccggttgagcatctcagcc
cagttcctctcacgcctccagaagacatccaggttcacccacaccttccctgcccagctg
ccccggcaccttgtgaagtccccagaggtcaaactcacggaccctgggggcagtcagccc
agagcagagcccccgagagcaggcactggccacacctccccaggcagaaccaacgtccct
cctgggaaaaagcctgaggagcccgttgagatcctagaggcctggtgcccactgaccccc
tgcctcacaggtccggcaccctgtgccccctcctcctcagtgctgcccaccgacaggaag
ccttcgacacccacagccctgcccactccaggcctggctcagggtgtccacagcccctcc
atccactcatacatggaggccactgccagctcccgtgccaagatgtcacgcagcatctcc
ctcgaggacagtgagggccctgtgctggctgagctggccaggcccctccgcaggccctca
tcagtcggggagctggcatccctgggccaggagctccaggccaaccccaccacggcagca
ctcagttctaacagtgagggccgagaacctgtcctgccctcctggggcaaccatgaggcc
cgggcgagtctgaagctgaccctgtcgagcatctgtgacaggctcttgctacccccttcc
ccagtggaacctgtggccacccagcccagtgtcaccatcacaacagccaccttctcggcc
tccagccccgtggatgcaagcaccctggggctccacaaatccacctttctcccaaggctc
ctggcccctgagcccctcaatacccctgcccaccccaacagcaccccacttccagaggcc
aggcctggggtccctggcagcatcacctccatcctggagacaacccctgatgcactcagt
ctggcccagggcaatcttggacactgggaggagcctagggtgccagccagggtcccgccc
tcagctcgcctagacctgagcactgtgagtactatcgtgcacagactgcagactgccttc
caggaagccctggacctttacaacgtgatggtctcccgtgacgaggtgagcagtgagcag
cagcaggcacggactgaactggcctccacctttgtttggatccatagccagttagaagcc
agtgactggctggttggaactgatgtggcccaggcccagcccagcccaaggtcctcctcc
ccaactacattgtgccccctggccagcccagatttgcatgccctgctggaacactactcg
gagctgctggtgcaggctgtgcggaggaaggcacggggggattga

DBGET integrated database retrieval system