KEGG   Acinonyx jubatus (cheetah): 106974883
Entry
106974883         CDS       T04657                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04110  Cell cycle
aju04114  Oocyte meiosis
aju04115  p53 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04934  Cushing syndrome
aju05161  Hepatitis B
aju05162  Measles
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05206  MicroRNAs in cancer
aju05215  Prostate cancer
aju05222  Small cell lung cancer
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106974883 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106974883 (CCNE2)
   04114 Oocyte meiosis
    106974883 (CCNE2)
   04115 p53 signaling pathway
    106974883 (CCNE2)
   04218 Cellular senescence
    106974883 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106974883 (CCNE2)
   05206 MicroRNAs in cancer
    106974883 (CCNE2)
   05203 Viral carcinogenesis
    106974883 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    106974883 (CCNE2)
   05215 Prostate cancer
    106974883 (CCNE2)
   05222 Small cell lung cancer
    106974883 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106974883 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106974883 (CCNE2)
   05161 Hepatitis B
    106974883 (CCNE2)
   05162 Measles
    106974883 (CCNE2)
   05169 Epstein-Barr virus infection
    106974883 (CCNE2)
   05165 Human papillomavirus infection
    106974883 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aju03032]
    106974883 (CCNE2)
   03036 Chromosome and associated proteins [BR:aju03036]
    106974883 (CCNE2)
DNA replication proteins [BR:aju03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    106974883 (CCNE2)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106974883 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106974883
NCBI-ProteinID: XP_014927647
UniProt: A0A6J1ZTT3
LinkDB
Position
Unknown
AA seq 406 aa
MSRRSSRLQAKQQQQPQPSQTDSPPEAQIIQAKKRKTAQDVKKRKEEVTKRHQYEIRNCW
PPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSNDVWLNML
KKETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQK
DINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWEL
CPVTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAA
AALCHFTSIEVVKKASGLEWDNISECVDWMVPFASVVKSTSPVKLKIFKKISMEDRHNIQ
THTNYLAMLDEVNYVNTFQKGGQLSPVCSGGIMTPPKSTEKPPGKY
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcaacagcagcaaccccagcccagccag
acggattcccctccagaagcccagataattcaggccaagaagagaaaaacagcccaggat
gtcaaaaaaagaaaagaggaggtcaccaagagacatcagtatgagattaggaattgttgg
ccacctgtattatctggagggatcagtccttgtataatcattgaaacaccccacaaagaa
ataggaacaagtgacttctccagatttacaaattacagatttaaaaatctttttattaat
ccttcacctttgcctgatttaagttggggatgctcaaatgatgtttggctaaacatgcta
aaaaaagagactagatatgttcatgacaaacattttgaagttctgcattctgacctggaa
ccacagatgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacactt
catagagaaacattttacctcgcacaagacttttttgacagatttatgttgacacaaaag
gatataaataaaaatatgcttcagctcattggaattacctcattattcattgcttccaaa
cttgaggaaatctatgctcctaagctccaagagtttgcttatgtcactgatggtgcctgc
agtgaagaggatatcttaagaatggaacttattatattaaaggctttaaaatgggaactc
tgtcctgtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaagat
gctcctaaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagctt
ttagatctgtgtattctagccatcgactcattagaattccagtacagaatcctggctgcc
gctgccttgtgccattttacctctattgaagtggttaagaaagcctcaggtttggaatgg
gacaacatttctgaatgtgtagactggatggtgccttttgccagtgtagtaaaaagtact
agtcctgtgaagctgaagatttttaagaagatttctatggaagacagacacaatatccag
acacatacaaattatctggctatgctggatgaagtaaattatgtaaacacctttcaaaag
gggggacagttgtcaccagtgtgcagtggaggcattatgacaccaccgaagagcactgaa
aaaccaccaggaaaatactaa

KEGG   Acinonyx jubatus (cheetah): 106975766
Entry
106975766         CDS       T04657                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04110  Cell cycle
aju04114  Oocyte meiosis
aju04115  p53 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04934  Cushing syndrome
aju05161  Hepatitis B
aju05162  Measles
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05206  MicroRNAs in cancer
aju05215  Prostate cancer
aju05222  Small cell lung cancer
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106975766 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106975766 (CCNE1)
   04114 Oocyte meiosis
    106975766 (CCNE1)
   04115 p53 signaling pathway
    106975766 (CCNE1)
   04218 Cellular senescence
    106975766 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106975766 (CCNE1)
   05206 MicroRNAs in cancer
    106975766 (CCNE1)
   05203 Viral carcinogenesis
    106975766 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    106975766 (CCNE1)
   05215 Prostate cancer
    106975766 (CCNE1)
   05222 Small cell lung cancer
    106975766 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106975766 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106975766 (CCNE1)
   05161 Hepatitis B
    106975766 (CCNE1)
   05162 Measles
    106975766 (CCNE1)
   05169 Epstein-Barr virus infection
    106975766 (CCNE1)
   05165 Human papillomavirus infection
    106975766 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aju03032]
    106975766 (CCNE1)
   03036 Chromosome and associated proteins [BR:aju03036]
    106975766 (CCNE1)
DNA replication proteins [BR:aju03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    106975766 (CCNE1)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106975766 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Connexin50
Other DBs
NCBI-GeneID: 106975766
NCBI-ProteinID: XP_026900443
UniProt: A0A6J1Y6U8
LinkDB
Position
Unknown
AA seq 410 aa
MPRERRERDAKERDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKIDRTVRNQCSSQ
PWDGSSVCENPCSLIPTPDKEEDEPTYPSSTCGPQSFMPSRASPLPILNWANRDEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGEEILSMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEQNRISPLPTGVLTPPQSSKKQSSGQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagagaagggagagggatgcaaaggaacgggacaccatgaaagaggaaagt
ggcaccgatgtctctgttcgctccaggaaaagaaaggcaaatgtggctgtttttttgcag
gatccagatgaagaaattgcaaaaattgacaggactgtgagaaaccagtgcagcagtcag
ccttgggatggcagttcagtgtgtgaaaacccctgctccttgattcctacacctgacaaa
gaagaggatgagccaacgtaccctagttccacctgtgggcctcagagtttcatgccctcc
agagcctcaccactgcctatactgaactgggcaaatagagacgaggtttggaaaatcatg
ttaaacaaggagaagacctacttaagggataagcactttatgcagcggcaccctctcctg
cagcctaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatatcgtaaaaacacttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctatcctccaaagctgcaccagtttgcgtatgttacagatggggct
tgttcaggagaggaaattcttagcatggaattaatcattatgaaggcccttaagtggcat
ttaagtcccctgaccattgtgtcctggctgaatgtatatatgcaggttgcatatctaaat
gatttatatgaagtgctcctgccacagtatcctcagcaaatcttcatacagattgcagag
cttttagatctttgtgtcctggatgttggctgcttagaatttccctatggtgtacttgct
gcttctgccttgtatcatttctcttcctctgaattgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccatttgcaatggtcataagggag
acaggaagttcaaaacttaagcacttcaggggagttcctgctgaagatgcacacaacatc
cagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tctgaacaaaacaggatttctcctctccccaccggggtcctcactcccccacagagcagc
aagaagcagagcagtgggcaggggacagcgtga

DBGET integrated database retrieval system