KEGG   Acinonyx jubatus (cheetah): 106974966
Entry
106974966         CDS       T04657                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04310  Wnt signaling pathway
aju04350  TGF-beta signaling pathway
aju04371  Apelin signaling pathway
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04659  Th17 cell differentiation
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05161  Hepatitis B
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05220  Chronic myeloid leukemia
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106974966 (SMAD4)
   04350 TGF-beta signaling pathway
    106974966 (SMAD4)
   04390 Hippo signaling pathway
    106974966 (SMAD4)
   04371 Apelin signaling pathway
    106974966 (SMAD4)
   04068 FoxO signaling pathway
    106974966 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106974966 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106974966 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    106974966 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    106974966 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106974966 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106974966 (SMAD4)
   05212 Pancreatic cancer
    106974966 (SMAD4)
   05225 Hepatocellular carcinoma
    106974966 (SMAD4)
   05226 Gastric cancer
    106974966 (SMAD4)
   05220 Chronic myeloid leukemia
    106974966 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106974966 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106974966 (SMAD4)
   05161 Hepatitis B
    106974966 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 106974966
NCBI-ProteinID: XP_014927744
UniProt: A0A6J2A4P4
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaagagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaactggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggctggtcggaaaggatttcctcatgtgatatatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactcaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtaaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgaagggcagccatcattatccactgaaggtcattcaattcaa
accatccaacatccaccaagtaatcgtgcctcaacggagacatacagcaccccagctctg
ttagctccatctgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaagttggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatatgtggacccttctggaggagat
cgcttttgcttgggtcaactctcgaatgtccacaggacagaagccattgaaagagcaagg
ttgcacataggcaaaggtgtgcagctggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccatgcagtctttgtgcagagttactacttagacagagaagcgggccgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcggcagatgcagcagcaggcggccactgctcaagctgcagccgctgcg
caggccgccgccgtggcaggaaacatccctggccctggatcagtaggtggaatagctcca
gctatcagtttgtcagctgctgccggtattggtgtcgatgaccttcgccgtttgtgcata
ctcaggatgagttttgtgaagggctggggaccggattacccaagacagagcatcaaagaa
acgccttgctggatcgagattcacttacaccgggccctccaactcttagatgaagtgctt
cataccatgcctattgctgacccacagcctttagactga

DBGET integrated database retrieval system