KEGG   Acinonyx jubatus (cheetah): 106975286
Entry
106975286         CDS       T04657                                 

Gene name
TP73
Definition
(RefSeq) tumor protein p73 isoform X1
  KO
K10148  tumor protein p73
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04115  p53 signaling pathway
aju04390  Hippo signaling pathway
aju04722  Neurotrophin signaling pathway
aju05162  Measles
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    106975286 (TP73)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106975286 (TP73)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    106975286 (TP73)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    106975286 (TP73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106975286 (TP73)
Transcription factors [BR:aju03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    106975286 (TP73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 106975286
NCBI-ProteinID: XP_026916437
UniProt: A0A6J1ZG33
LinkDB
Position
Unknown
AA seq 632 aa
MSQPTAAADEGATFEHLWRSLEPDSTYFDLPQPSQGNNAVVSGSGASMDVLHLQGMTTPV
MPQFNLLNSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPAIPSNADY
PGPHHFDVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTVIRAMPVY
KKAEHVTEVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPYE
PPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRD
RKADEDHYREQQALSESAAKNGAGSKRAFKQSPPAVPALGTNVKKRRHGDEDVYYMHVRG
RENFEILMKVKESLELMELVPQQLVDAYRQQQQQLQRPSHLQPASYGPVLSPMNKAHGGV
NKLPSVNQLVGQPPPHGSAAGPNLGPVGPGILNNHSHALPANGEMNSGHGAQSMVSGSHC
TPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQNIYHLQNLTIEDLGALKIPDQYRMTIW
RGLQDLKQSHDYGAQQLIRSSSNASAIAVGSSGELQRQRVMEAVHFRVRHTITIPNRGGP
GPDEWADFGFDLPDCKSRKQSIKEEFTESEIN
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgtcccagcccaccgccgccgccgatgagggggccacgttcgagcacctgtggagatcc
ctggaaccagacagcacctactttgaccttccccagccaagccagggaaataacgcggtg
gtgagcggctcaggggccagcatggatgtcttgcacttgcagggcatgaccacgcccgtc
atgccccagttcaatctgctgaacagcaccatggaccagatgagcagccgagcggcctcg
gccagcccctacaccccggagcacgccgccagcgtgcccacccactcgccctacgcgcag
cccagctccaccttcgacaccatgtcgcccgcaccggccatcccctccaacgccgactac
cccggcccccaccacttcgatgttaccttccagcagtcgagcacggccaagtcggccacc
tggacgtactccccgctgctgaagaagctttactgccaaatcgccaagacgtgccccatc
cagatcaaggtgtccaccccgccgcccccgggcaccgtcatccgggccatgcccgtctac
aagaaggcagagcacgtgactgaggtggtgaagcgctgccccaaccatgagctcgggcga
gacttcaatgaaggacagtctgctccggccagccacctcatccgcgtggagggcaacaat
ctctcacagtacgtggacgaccctgtcacaggcaggcagagtgtcatggttccctacgag
cccccgcaggtggggacagaatttaccaccatcctgtacaacttcatgtgcaacagcagt
tgtgtggggggcatgaaccggaggcccatcctcatcatcatcaccctggagacccgggac
ggacaggtgctgggccgcaggtccttcgagggccgcatctgcgcctgtcccggccgagac
cgcaaggctgacgaggaccactaccgcgagcagcaggccctgagcgagagtgcggccaag
aacggggctggcagcaagcgcgccttcaaacagagccccccagccgtccccgccctgggc
accaacgtgaagaagaggagacacggggacgaggatgtgtactacatgcacgtgcggggc
cgagagaactttgagatcctgatgaaggtcaaggagagcctggagctgatggaactggtg
ccacagcagctcgtggacgcctaccggcagcagcagcagcagcttcagaggccgagccac
ctgcagccggcgtcctacgggcccgtcctctcgcccatgaacaaagcgcacgggggtgtc
aacaaactgccgtccgtcaaccagctggtgggccagcctcccccgcacggctcggcggcc
gggcccaacctggggcccgtgggccccgggatcctcaacaaccacagccacgccctgcca
gccaacggcgagatgaacagcggccacggcgcccagtccatggtctcggggtcccactgc
accccacccccctaccacgccgaccccagcctggtcagttttttaacaggattggggtgt
ccaaactgcatcgagtatttcacctcccaaggcttacagaacatttaccacctgcagaat
ctgaccatagaggacctcggggccctgaagatcccggaccagtaccggatgaccatctgg
aggggcctgcaggacctgaagcagagccacgactacggcgcccagcagctgatccgctcc
agcagcaacgcgtccgccatcgccgtgggcagctccggggagctgcagcggcagcgggtc
atggaggccgtgcacttccgcgtgcgccacaccatcaccatccccaaccgcgggggcccg
gggcccgacgagtgggcggacttcggcttcgacctcccggactgcaagtcccggaaacag
tccatcaaagaggagttcacggagagcgagatcaactga

DBGET integrated database retrieval system