KEGG   Acinonyx jubatus (cheetah): 106975307
Entry
106975307         CDS       T04657                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2
  KO
K04385  axin 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106975307 (AXIN2)
   04390 Hippo signaling pathway
    106975307 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106975307 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106975307 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106975307 (AXIN2)
   05225 Hepatocellular carcinoma
    106975307 (AXIN2)
   05226 Gastric cancer
    106975307 (AXIN2)
   05217 Basal cell carcinoma
    106975307 (AXIN2)
   05213 Endometrial cancer
    106975307 (AXIN2)
   05224 Breast cancer
    106975307 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106975307 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    106975307 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106975307 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106975307 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106975307 (AXIN2)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106975307 (AXIN2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 106975307
NCBI-ProteinID: XP_026903872
UniProt: A0A6J1YFU2
LinkDB
Position
Unknown
AA seq 842 aa
MSSAVLVTRLPDPSSSFHEDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNARRNEG
GLGEPEGRASPDSPLTRWTKSLHYLLGDQDGAYLFRTFLERDKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIRKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWACADFK
CKLSPTVVGLSSKTLRATANARSAETVENGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEASELALSSREGGPTP
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHQQHHPL
LPPGGKLPPVAASQAGCPLLGAKGFVTKQTTKHVHHHYIHHHALPKTKEEIEAEAAQRVR
CFCPGGSEYYCYSKCKSHPRALEPVPAEQFGSRGGTPPRRTGKSVEPGPALPAREGGAPG
GPGALQLPGEEGDRSQDVWQWMLESERQSRPKPHSAQSTKRAYPLECARASPAERAGRHH
LLGGSNGHPRAAPRAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCAASQQ
RDRNHSAVGQAGATPSSNPSLASEDHKEPKKLAAVHALQASELVVTYFFCGEEIPYRRML
KAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDEAVLPMYEGRILGKVER
ID
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgagcagtgctgtgctggtgactcgcctcccagaccccagcagcagcttccacgaggat
gccccccggccccccgttccgggggaagaaggggagaccccaccgtgccagcccggggtg
ggaaagggccaggtcaccaaacccatgcctgtctcctccaacgccaggcggaacgagggt
gggctgggagagcctgaggggcgggcatccccggactcccctctgaccaggtggaccaag
tctttgcactatttgttgggtgatcaagacggtgcttatctcttccgcactttcctggag
agggacaaatgcgtggataccttggacttctggtttgcctgcaatgggttcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacatcgag
aacaacagcatcgtctccaagcagctgaagcctgccaccaagacctacattagagatggc
atcaggaagcagcagattgactccatcatgttcgaccaggcccagactgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaacgggggcctggggagtctaaaggtc
gtatgtggctacctccccaccttgaatgaggaagaggagtgggcttgtgccgacttcaag
tgcaaactgtcacccaccgtggtgggcttgtccagcaaaaccctgagggctacagccaac
gcgaggtccgcggagaccgttgaaaatggatacaggtccttcaagaggagcgaccctgtt
aatccataccacgtaggttctggctatgtcttcgcgccggctaccagcgccaatgatagc
gagatatccagcgatgcactgactgatgattccatgtccatgacggacagtagtgtagat
ggaatccctccttatcgtgtggggagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggagcccgccacctttgcggccgagctcatctccaggctggagaag
ctgaagctggagctggagagccggcacagcctggaggagcgcctgcagcagatccgagag
gatgaagagaaggaagcctctgagctagcgctgagctccagggaggggggccccaccccg
caccccctctccctcctgccctccggcagctacgaggaggacccgcagaccattctggac
gaccacctgtccagggtcctcaagacccccggctgccagtcgccgggcgtgggccgctac
agcccccgctcccgttcccccgaccaccaccaccaccaccaccagcagcaccaccccctc
ctcccgcccgggggcaagttgccccccgtggccgcctcgcaggccggttgccccctcctg
ggagccaagggcttcgtgaccaagcagacgacgaagcacgtccaccaccactacatccac
caccacgccctccccaagaccaaggaggagatcgaggcggaggccgcacagagggtgcgc
tgcttctgcccggggggctccgagtattactgctactcgaagtgcaagagccaccccagg
gctctggagcccgtgccggccgagcagttcggcagcagaggtggtaccccgcccagacgg
accgggaaaagcgtggagccgggcccggccctgccagccagggaaggaggcgccccaggc
ggacccggggccctgcagctgcccggggaggaaggagacaggtcgcaggatgtctggcag
tggatgctggagagtgagcggcagagcaggcccaagccccatagtgcccagagcacaaaa
agggcctaccccttagagtgcgcccgcgcgtcccccgccgagcgagccggtcggcaccac
ctgctggggggcagtaacgggcacccccgcgctgccccccgagcccacccgttcacccag
gaccccgcgatgcctcccctgaccccacccaacacgctggcgcagctagaggaagcctgc
cgcaggttggccgaggtgtccaagccccccaagcagcggtgctgtgcggccagtcagcag
agggacaggaaccactcggccgttggtcaggcgggagccacgccctcctctaacccaagc
ctggcttcagaagatcacaaagagccaaagaagctggcggcggtgcacgcgctccaggcc
agcgagctggtcgtcacgtactttttctgtggagaagaaattccatacaggaggatgctg
aaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaattat
aggtattacttcaaaaaagcaagcgacgagtttgcctgcggagccgtgtttgaggagatc
tgggacgatgaggccgtgctccccatgtacgaaggcaggattctggggaaggtggagagg
atcgattga

KEGG   Acinonyx jubatus (cheetah): 106977359
Entry
106977359         CDS       T04657                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04310  Wnt signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04934  Cushing syndrome
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05165  Human papillomavirus infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05217  Basal cell carcinoma
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106977359 (AXIN1)
   04390 Hippo signaling pathway
    106977359 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106977359 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106977359 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106977359 (AXIN1)
   05225 Hepatocellular carcinoma
    106977359 (AXIN1)
   05226 Gastric cancer
    106977359 (AXIN1)
   05217 Basal cell carcinoma
    106977359 (AXIN1)
   05213 Endometrial cancer
    106977359 (AXIN1)
   05224 Breast cancer
    106977359 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106977359 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    106977359 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106977359 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106977359 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106977359 (AXIN1)
Protein phosphatases and associated proteins [BR:aju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106977359 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin Sec16
Other DBs
NCBI-GeneID: 106977359
NCBI-ProteinID: XP_026899561
UniProt: A0A6J1Y3R0
LinkDB
Position
Unknown
AA seq 867 aa
MSIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPISHSFCSGKGAGVKGETSAAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLAKAIYRKYILDNNGIVSRQTKPATKSFIKDCIMKQLIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGIPGYLPT
LNEDEEWKCDQDLHEDSGRDPAPPGRLTQKLLLETAAPRASSSRRSSEGREFRCGSWREP
ANPYYVSSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGVPPYRTRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEVRVEPQKFAAELIHRLEAIQRTREAEEKLEERLKRVRMEE
EGEDGDMPSGPPGATHKLPLATAWHHFPPRYADVGCVGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSGHVPKIVGVLGGVPPGHSKHAPKSGVKLDAAGPHLHRHGHHHSH
HGAARPKEQAEAEASRRIPGSFSWGPELHGHTAKPRSHSESVGTAPNASDSLAYSGKSGT
ASRRNAKKAESGKSAGAEVPGPSEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGAKKQQ
VHESPRPLSVERPGAVHPWVSAQLRNSVQPSHLFVQDPTMPPNPAPNPLTQLEEARRRLE
EEEKRASKLPSKQRYVQEVIQRGRSCVRPACTPVLSVVPAVSDLELSETESKSQRKAGSG
SAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTRKGNYRYYFKKVSDEFDCGV
VFEEVREDETILPVFEEKIIGKVEKVD
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgagtatccaagagcagggtttccctttggaccttggagcgagtttcaccgaagatgcc
ccccgacccccagtgcctggtgaggagggtgaactggtgtccacagaccccaggcccatc
agccacagcttctgctccgggaagggtgccggggttaaaggtgagacttcagcagccaca
ccaaggcgctcggatctggacctggggtatgagcctgagggcagcgcctcccccaccccg
ccatacttgaagtgggctgagtcgttgcactcgttactggacgatcaagatgggataaac
ctgtttaggactttcctgaagcaggaggactgtgctgacctgctggacttctggttcgcc
tgcagcggcttcaggaagctggagccctgtgactcgaatgaggaaaagaggctgaagttg
gccaaagccatttaccgcaaatatatcctcgataacaacggcatcgtatccaggcaaact
aagccagctaccaagagcttcataaaggactgcatcatgaagcagctgatagatcctgcc
atgtttgaccaggcccagacggagatccagtccaccatggaagaaaacacctacccctcc
ttcctcaagtctgatatttatttggaatatacgaggacaggctcggagagcccaaagctc
tgtagtgaccagagctctgggtcggggacagggaagggcatacctggatacctgcccact
ttgaatgaagatgaggaatggaagtgtgaccaggacctgcacgaagacagcggcagagac
cctgctccccccggcaggctcacgcagaagctgcttctggagacggctgccccgcgggcc
tcctcaagtagacggtccagcgaaggcagagaattcaggtgcgggtcctggcgggagcct
gccaacccctactacgtcagctccggctacgccctcgccccggccaccagtgccaacgac
agtgagcagcagagcctatccagtgatgccgacagcctgtccctcaccgacagcagcgtg
gatggagtcccgccatacaggacccgtaagcagcaccgccgggagatgcaagagagcgtc
caggtcaacgggcgggtgcccctacctcacatccctcgcacttaccgaatgccaaaggaa
gtccgcgtggagccccagaagttcgccgcggagctcatccaccgcctggaggccatccag
cggacacgggaggccgaggagaagctggaggagcggctgaaacgcgtccggatggaggaa
gaaggtgaggatggtgacatgccctctggtcccccgggggccactcataagctgcctttg
gccacagcctggcaccacttcccgccccgctatgcagacgtgggctgcgtgggtctgcgg
gacgcgcacgaggagaaccctgagagcatcctggatgagcatgtgcagcgggtcatgagg
acaccgggctgtcagtcgccggggcccggccaccgttcccctgacagcgggcacgtgccc
aagattgtgggggtcctagggggtgtgccccctgggcacagtaagcacgcacctaagtcc
ggggtgaagctggacgcagccggcccacacctgcacaggcacggccaccaccacagtcac
cacggggcggccaggcccaaggagcaggctgaggcggaggcctcccgccgcatcccgggc
agcttctcttggggcccggagctgcatggccacacagccaagccccgtagccactcagag
agcgtgggcaccgcccccaatgcgagcgacagcctggcctacagcgggaagtctggcact
gcctccagaagaaacgccaagaaggcggagtcagggaagagcgcgggagccgaggtgcct
ggcccctcggaagacgcagagaagaaccaaaagatcatgcagtggatcatcgagggggag
aaggagatcagccggcaccgcaaggctggccacgggtcttccggtgccaagaagcagcag
gtgcacgagagccccaggcccttgtccgtggagcgtcccggggctgtgcacccttgggtc
agcgctcagcttcgcaactccgtccagccctctcacctcttcgttcaagaccccaccatg
ccacccaacccagcccccaaccctctgacccagctggaggaggcccgcaggcgcctggag
gaggaagagaagagagccagcaaattaccctcaaagcagaggtatgtgcaggaggtcatc
cagcgggggcgctcctgtgtcaggccagcgtgcacacctgtgctgagcgtggtgccagcc
gtgtccgacttggagctctcggagacagagtcgaagtcgcagaggaaggcgggcagtggg
agcgcccagccgtgtgacagcatcgtggtggcctattacttctgcggggagcccatcccg
taccggaccctggtgcggggccgagccgtcactctgggccagttcaaggagctgctgacc
aggaagggcaactacagatactacttcaagaaggtgagcgacgagtttgactgcggcgtg
gtgtttgaggaggttcgggaagatgagaccatcctgccggtcttcgaggagaagatcatc
ggcaaggtggagaaggtggactga

DBGET integrated database retrieval system