KEGG   Acinonyx jubatus (cheetah): 106975594
Entry
106975594         CDS       T04657                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04115  p53 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04370  VEGF signaling pathway
aju04919  Thyroid hormone signaling pathway
aju05010  Alzheimer disease
aju05012  Parkinson disease
aju05014  Amyotrophic lateral sclerosis
aju05016  Huntington disease
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05134  Legionellosis
aju05145  Toxoplasmosis
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05215  Prostate cancer
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106975594 (CASP9)
   04151 PI3K-Akt signaling pathway
    106975594 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106975594 (CASP9)
   04215 Apoptosis - multiple species
    106975594 (CASP9)
   04115 p53 signaling pathway
    106975594 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    106975594 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106975594 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106975594 (CASP9)
   05212 Pancreatic cancer
    106975594 (CASP9)
   05215 Prostate cancer
    106975594 (CASP9)
   05213 Endometrial cancer
    106975594 (CASP9)
   05222 Small cell lung cancer
    106975594 (CASP9)
   05223 Non-small cell lung cancer
    106975594 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106975594 (CASP9)
   05012 Parkinson disease
    106975594 (CASP9)
   05014 Amyotrophic lateral sclerosis
    106975594 (CASP9)
   05016 Huntington disease
    106975594 (CASP9)
   05020 Prion disease
    106975594 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    106975594 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106975594 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    106975594 (CASP9)
   05152 Tuberculosis
    106975594 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106975594 (CASP9)
   05161 Hepatitis B
    106975594 (CASP9)
   05160 Hepatitis C
    106975594 (CASP9)
   05164 Influenza A
    106975594 (CASP9)
   05162 Measles
    106975594 (CASP9)
   05168 Herpes simplex virus 1 infection
    106975594 (CASP9)
   05163 Human cytomegalovirus infection
    106975594 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106975594 (CASP9)
   05169 Epstein-Barr virus infection
    106975594 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106975594 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106975594 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106975594 (CASP9)
   01002 Peptidases and inhibitors [BR:aju01002]
    106975594 (CASP9)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     106975594 (CASP9)
Protein phosphatases and associated proteins [BR:aju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106975594 (CASP9)
Peptidases and inhibitors [BR:aju01002]
 Cysteine peptidases
  Family C14: caspase family
   106975594 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 Haem_oxygenas_2
Other DBs
NCBI-GeneID: 106975594
NCBI-ProteinID: XP_026916147
UniProt: A0A6J1ZFA5
LinkDB
Position
Unknown
AA seq 451 aa
MDEADRQLLRRCRVRLVGELQVASLWDALLTRQLFTPAMIEDIQHAGSGSRSDQVRQLVI
DLETRGSQALPLFISCLEDTGQDALASLLRMGRQAEKQNPQAVRPLDLMPVVVGPMGLKP
EELRRRQYPLKPTPEKLTPVVLGPEELWPAKLRPEVLRPEVPRPVDIGSGPFSDICAQEI
SKRNADLAYVLNADPCGHCLIINNMNFCLESRLQTRTGSNIDCEKLQRRFFLLHFVVDVK
HDQTAKQMVQVLVELAQRDHGALDCCVVVILSHGCQASHRQFPGAVYGTDGCPVSIEKIV
NIFNGSGCPSLGGKPKLFFIQACGGERKDHGVEVASTSPEDRTPGSDSEPDAVPFQEGPG
TFDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSWYVETLDGVFEQWARSEDLQTLM
LRVANAVSQKGIYKQIPGCFNFLRKKLYFKM
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggacgaggctgaccggcagctcctgcggcggtgccgtgtgcggctggtcggcgagctg
caggtggcctcgctctgggacgctctgctgacccgccagctcttcacgcccgcgatgatc
gaggacatccagcatgcgggctcagggtctcggagcgatcaggtcaggcagcttgtcata
gatctagagacccgagggagtcaggcccttcctttgttcatctcctgcttagaggacaca
ggccaggatgcactggcttcattgctgagaatgggtcggcaagcagaaaagcagaatcca
caggctgtcagacccctggacctcatgcctgtggtggttggaccaatgggcctcaaacca
gaggagctcagaaggaggcagtatcctttaaagccgactccggaaaaactcactccagtg
gtgttggggcccgaagagctgtggccagccaagctccggccagaggttctcagaccagag
gtgcctaggccagtggacattggttctggaccattcagtgatatctgtgctcaggaaatt
tcgaagcgaaatgctgatttggcgtatgtcctgaacgcggacccctgtggccactgcctc
atcatcaacaacatgaacttctgcctcgagtcgaggctccagacccgtaccggctccaat
atcgactgtgagaagttgcagcgacgtttcttcttgctgcatttcgtggtggacgtgaag
cacgaccagacggccaagcaaatggtccaggtgttggtggagctggctcagcgggaccat
ggtgctctggactgctgcgtggtggtcatcctctctcacggctgtcaggccagccaccgc
cagttcccaggggctgtttatggcacagatggctgtcctgtgtccatcgagaaaattgtg
aacatcttcaatggatccggctgccccagcttgggagggaagcccaagctcttctttatc
caggcctgtggtggggagcggaaagaccatggggttgaggtggcctccacgtcccctgaa
gacaggacccctggcagtgactccgagccagacgctgtcccgttccaggaaggcccaggc
acctttgaccagccggacgccgtgtctagtttgcccacacccagtgacatctttgtgtcc
tactccaccttcccaggttttgtttcctggagggacaccaagagcggctcctggtacgtg
gagaccttggatggtgttttcgagcagtgggctcgctctgaggacctgcagaccctcatg
ctcagggtcgctaatgctgtttcgcagaaagggatttacaagcagattcctggttgtttc
aatttcctccggaaaaaactttactttaaaatgtaa

DBGET integrated database retrieval system