KEGG   Acinonyx jubatus (cheetah): 106975612Help
Entry
106975612         CDS       T04657                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00020  Citrate cycle (TCA cycle)
aju00190  Oxidative phosphorylation
aju01100  Metabolic pathways
aju01200  Carbon metabolism
aju04714  Thermogenesis
aju04932  Non-alcoholic fatty liver disease (NAFLD)
aju05010  Alzheimer disease
aju05012  Parkinson disease
aju05016  Huntington disease
Module
aju_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aju_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aju_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106975612 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106975612 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    106975612 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    106975612 (SDHB)
   05012 Parkinson disease
    106975612 (SDHB)
   05016 Huntington disease
    106975612 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    106975612 (SDHB)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106975612 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 106975612
NCBI-ProteinID: XP_026916096
LinkDB All DBs
Position
Unknown
AA seq 281 aa AA seqDB search
MAAAAVGVSLRRRFPATALGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPRMQ
TYEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDT
NLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREK
LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFS
LYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKGKKASV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggtcggagtctccttgaggcgccggttcccggccacggcccttggc
ggagcctgcctgcaggcctgccggggggcacagacagcggcagccacagctccccgaatc
aagaagtttgccatctaccgatgggacccagacaagacgggagataagcctcgtatgcaa
acttatgaaattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagatt
aagaatgaaattgattcgactttgactttccgacgatcatgcagagaaggcatctgtggc
tcttgcgcgatgaacatcaacggaggcaacactctggcttgcacccgcaggattgacacc
aacctcagcaaagtctccaaaatctaccctcttccacatatgtatgtgataaaggatctt
gttcccgacttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaag
aaggatgaatcccaggaaggcaagcagcagtacctgcagtccatagaagatcgtgagaaa
ctggacgggctgtatgagtgtattctctgtgcctgctgcagcaccagctgccccagctac
tggtggaacggagacaaatacctgggacccgcagtccttatgcaggcctatcgctggatg
atcgactccagagacgacttcacggaggagcgcctggccaagctgcaggacccgttctcc
ctgtatcgctgccacaccatcatgaactgcacgaggacctgccccaaggggctgaatcca
ggcaaagctattgctgaaatcaagaaaatgatggccacctataaggggaagaaagcgtca
gtgtaa

DBGET integrated database retrieval system