KEGG   Acinonyx jubatus (cheetah): 106976197Help
Entry
106976197         CDS       T04657                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00480  Glutathione metabolism
aju00980  Metabolism of xenobiotics by cytochrome P450
aju00982  Drug metabolism - cytochrome P450
aju00983  Drug metabolism - other enzymes
aju01524  Platinum drug resistance
aju05200  Pathways in cancer
aju05204  Chemical carcinogenesis
aju05225  Hepatocellular carcinoma
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    106976197 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106976197 (MGST2)
   00982 Drug metabolism - cytochrome P450
    106976197 (MGST2)
   00983 Drug metabolism - other enzymes
    106976197 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    106976197 (MGST2)
   05204 Chemical carcinogenesis
    106976197 (MGST2)
   05225 Hepatocellular carcinoma
    106976197 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    106976197 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    106976197 (MGST2)
Enzymes [BR:aju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106976197 (MGST2)
Transporters [BR:aju02000]
 Other Transporters
  Pores ion channels [TC:1]
   106976197 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 106976197
NCBI-ProteinID: XP_014929098
LinkDB All DBs
Position
Un
AA seq 146 aa AA seqDB search
MAGHSILLAAVSVLSACQQSYFALHVGKARLKYKVTAPAVSGSPEFERIFRAQQNCVEFY
PIFLITLWMAGWYFNQVFATCLGLVYIYARHQYFWGYSEAAKKRITGFRLSLAILALLTV
LGTLGIANSFLDEYMDLNVAKKLRHF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcattcaatcttgctggccgctgtctcagtcttgtccgcctgtcaacaaagt
tattttgctttgcatgtaggaaaggcaagattgaaatacaaagttacagccccagcagtc
tctgggtcaccagagtttgagagaatatttcgtgcacaacaaaactgtgtggagttttac
cccatatttctgattacattgtggatggctggatggtatttcaatcaagtttttgctacc
tgtctgggtcttgtgtacatatatgcccgtcaccagtatttctggggatattcagaagca
gctaaaaaaaggatcaccgggttccggctgagtctggcgattctggccttgctgacagtc
ctgggcaccctggggattgcaaacagctttctggatgaatacatggacctcaatgtcgcc
aagaaactgagacacttctaa

DBGET integrated database retrieval system