KEGG   Acinonyx jubatus (cheetah): 106976559
Entry
106976559         CDS       T04657                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X2
  KO
K05461  KIT ligand
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04072  Phospholipase D signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04640  Hematopoietic cell lineage
aju04916  Melanogenesis
aju05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106976559 (KITLG)
   04014 Ras signaling pathway
    106976559 (KITLG)
   04015 Rap1 signaling pathway
    106976559 (KITLG)
   04072 Phospholipase D signaling pathway
    106976559 (KITLG)
   04151 PI3K-Akt signaling pathway
    106976559 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106976559 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    106976559 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106976559 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aju04052]
    106976559 (KITLG)
Cytokines and growth factors [BR:aju04052]
 Growth factors
  Growth factors (RTK binding)
   106976559 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 106976559
NCBI-ProteinID: XP_014929477
UniProt: A0A6I9ZWI0
LinkDB
Position
Unknown
AA seq 274 aa
MKKTQTWIVTCIYLQLLLFNPLVKTKGLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPG
MDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSS
ENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattgtcacttgcatttatcttcagctgctcctatttaac
cctctggtcaaaactaaagggctctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagatagccctcaaatatgtccccggg
atggatgttttgcctagtcattgttggataagtgtgatggtggaacagttgtcagtcagt
ttgactgatcttctggacaagttttcgaatatttctgaaggcttgagtaattattctatc
atagacaaacttgtgaaaatagtggatgaccttgtggagtgcgtggaaggacactcatct
gagaatgtaaaaaaatcatctaagagcccagaacccaggctttttactcctgaagaattc
tttagaatttttaatagatccattgatgccttcaaggacttggagatggtggcatctaaa
actagtgaatgtgtggtttcttcaacattaagtcctgaaaaagattccagggtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggccacaaatcccatagaagactccagcatacaatgggcagtcatggca
ttaccagcgtgcttttctcttgtaatcggatttgcttttggagccttctactggaagaag
aaacaaccgaatctcacaaggacagttgaaaatatacagattaacgaagaggataatgag
ataagtatgctgcaagaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system