KEGG   Acinonyx jubatus (cheetah): 106976895
Entry
106976895         CDS       T04657                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04012  ErbB signaling pathway
aju04110  Cell cycle
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04310  Wnt signaling pathway
aju04350  TGF-beta signaling pathway
aju04390  Hippo signaling pathway
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04630  JAK-STAT signaling pathway
aju04919  Thyroid hormone signaling pathway
aju05132  Salmonella infection
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05163  Human cytomegalovirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05210  Colorectal cancer
aju05213  Endometrial cancer
aju05216  Thyroid cancer
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
aju05221  Acute myeloid leukemia
aju05222  Small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106976895 (MYC)
   04012 ErbB signaling pathway
    106976895 (MYC)
   04310 Wnt signaling pathway
    106976895 (MYC)
   04350 TGF-beta signaling pathway
    106976895 (MYC)
   04390 Hippo signaling pathway
    106976895 (MYC)
   04630 JAK-STAT signaling pathway
    106976895 (MYC)
   04151 PI3K-Akt signaling pathway
    106976895 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106976895 (MYC)
   04218 Cellular senescence
    106976895 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106976895 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    106976895 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106976895 (MYC)
   05202 Transcriptional misregulation in cancer
    106976895 (MYC)
   05206 MicroRNAs in cancer
    106976895 (MYC)
   05205 Proteoglycans in cancer
    106976895 (MYC)
   05230 Central carbon metabolism in cancer
    106976895 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106976895 (MYC)
   05225 Hepatocellular carcinoma
    106976895 (MYC)
   05226 Gastric cancer
    106976895 (MYC)
   05216 Thyroid cancer
    106976895 (MYC)
   05221 Acute myeloid leukemia
    106976895 (MYC)
   05220 Chronic myeloid leukemia
    106976895 (MYC)
   05219 Bladder cancer
    106976895 (MYC)
   05213 Endometrial cancer
    106976895 (MYC)
   05224 Breast cancer
    106976895 (MYC)
   05222 Small cell lung cancer
    106976895 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106976895 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106976895 (MYC)
   05161 Hepatitis B
    106976895 (MYC)
   05160 Hepatitis C
    106976895 (MYC)
   05163 Human cytomegalovirus infection
    106976895 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106976895 (MYC)
   05169 Epstein-Barr virus infection
    106976895 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106976895 (MYC)
   03019 Messenger RNA biogenesis [BR:aju03019]
    106976895 (MYC)
Transcription factors [BR:aju03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    106976895 (MYC)
Messenger RNA biogenesis [BR:aju03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     106976895 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH GTP-bdg_M
Other DBs
NCBI-GeneID: 106976895
NCBI-ProteinID: XP_026919716
UniProt: A0A6J1ZQM7
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAFASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGPGGCPTSSLYLQD
LSAAASECIDPSVVFPYPLNDTSSPKPCASPDSAAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEEEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRC
HVPTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCISPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAGEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctcgactacgactcggtgcag
ccctatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccg
ctgtccccgagccgccgctcggggctctgctcgccctcctacgtcgccttcgcgtccttc
tccccccggggggacgacgacggcggcggcggcagcttttccacggccgaccagttagag
atggtgaccgagctgctgggaggagacatggtgaatcagagcttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgcatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctggcctcctaccaggctgcgcgcaaagacagcggc
agcccgagccccgcccgcgggcccggcggctgccccacctccagcttgtacctgcaggac
ctgagcgccgccgcctccgagtgcatcgacccctccgtggtcttcccctacccgctcaac
gacaccagctcgcccaagccctgcgcctcccccgactccgccgccttctctccgtcctcg
gactctctgctctcctcggcggagtcctccccgcgggccagccccgagcccctggcgctc
cacgaggagacaccgcccaccaccagcagcgactctgaggaagaacaagaggaagaagaa
gaaattgatgtcgtttctgtggagaaaaggcagccccctgccaaaaggtcggaatcgggg
tcaccctctgccggaggccacagcaaacctcctcacagcccgctggtccttaagagatgc
cacgtgcccacccatcagcacaattacgcagcgcccccctccactaggaaggactaccca
gccgccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaaccgc
aaatgtatcagccccaggtcttcggacacggaagagaacgacaagaggcggacgcacaac
gtcttggaacgccagaggagaaacgagctgaaacggagcttttttgccctgcgcgaccag
atcccagagttggaaaacaacgaaaaggcccccaaggtggttatccttaaaaaagccacc
gcgtacatcctgtccgtccaagcaggggagcaaaagctcatttcggaaaaggacctgttg
aggaagcgacgagaacagttgaaacacaaacttgaacagctaaggaactcttgtgcataa

DBGET integrated database retrieval system