KEGG   Acinonyx jubatus (cheetah): 106977102
Entry
106977102         CDS       T04657                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04060  Cytokine-cytokine receptor interaction
aju04061  Viral protein interaction with cytokine and cytokine receptor
aju04151  PI3K-Akt signaling pathway
aju04625  C-type lectin receptor signaling pathway
aju04630  JAK-STAT signaling pathway
aju04658  Th1 and Th2 cell differentiation
aju04659  Th17 cell differentiation
aju04660  T cell receptor signaling pathway
aju04672  Intestinal immune network for IgA production
aju04940  Type I diabetes mellitus
aju05135  Yersinia infection
aju05142  Chagas disease
aju05162  Measles
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05320  Autoimmune thyroid disease
aju05321  Inflammatory bowel disease
aju05330  Allograft rejection
aju05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106977102 (IL2)
   04151 PI3K-Akt signaling pathway
    106977102 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106977102 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    106977102 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106977102 (IL2)
   04660 T cell receptor signaling pathway
    106977102 (IL2)
   04658 Th1 and Th2 cell differentiation
    106977102 (IL2)
   04659 Th17 cell differentiation
    106977102 (IL2)
   04672 Intestinal immune network for IgA production
    106977102 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106977102 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106977102 (IL2)
   05321 Inflammatory bowel disease
    106977102 (IL2)
   05330 Allograft rejection
    106977102 (IL2)
   05332 Graft-versus-host disease
    106977102 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106977102 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    106977102 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106977102 (IL2)
   05162 Measles
    106977102 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    106977102 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aju04052]
    106977102 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106977102 (IL2)
Cytokines and growth factors [BR:aju04052]
 Cytokines
  Interleukins
   106977102 (IL2)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Haparin
  Cytokines
   106977102 (IL2)
SSDB
Motif
Pfam: IL2 ICAT Leg1
Other DBs
NCBI-GeneID: 106977102
NCBI-ProteinID: XP_014930093
UniProt: A0A6I9ZWY1
LinkDB
Position
Unknown
AA seq 154 aa
MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML
TFKFYVPKKATELTHLQCLVEELTPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS
ETRFTCKYDDETATIVEFLNKWITFCQSIFSTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaaaattcaactcttgtcttgcattgcactgactcttatacttgtcacaaacagt
gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat
ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc
acatttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta
gaagaactcacacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg
aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct
gaaacaagattcacatgtaaatatgatgatgagacagcaaccattgtagaatttctgaac
aaatggattaccttttgtcaaagcatcttctcaacgctgacttga

DBGET integrated database retrieval system