KEGG   Acinonyx jubatus (cheetah): 106977731Help
Entry
106977731         CDS       T04657                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00010  Glycolysis / Gluconeogenesis
aju00030  Pentose phosphate pathway
aju00051  Fructose and mannose metabolism
aju00052  Galactose metabolism
aju01100  Metabolic pathways
aju01200  Carbon metabolism
aju01230  Biosynthesis of amino acids
aju03018  RNA degradation
aju04152  AMPK signaling pathway
aju05230  Central carbon metabolism in cancer
Module
aju_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106977731 (PFKP)
   00030 Pentose phosphate pathway
    106977731 (PFKP)
   00051 Fructose and mannose metabolism
    106977731 (PFKP)
   00052 Galactose metabolism
    106977731 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106977731 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    106977731 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    106977731 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106977731 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aju03019]
    106977731 (PFKP)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106977731 (PFKP)
Protein phosphatases and associated proteins [BR:aju01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106977731 (PFKP)
Messenger RNA biogenesis [BR:aju03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106977731 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106977731
NCBI-ProteinID: XP_026929114
LinkDB All DBs
Position
Unknown
AA seq 790 aa AA seqDB search
MDDDDVSARKGSFRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIMEANWESVSSILQVGGTIIGSARCKAFRTREGRLKAAGNLVQRGIT
NLCVIGGDGSLTGANIFRKEWSGLLQELAENGDIDREEVQKHAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWQEKMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLVEC
VQMTQDVQKAMDERRFKDAVRLRGRSFESNLNTYKRLAIKMPDDQIPKSNCNVAVINVGA
PAAGMNAAVRSAVRVGISEGHKMFAIYDGFEGFAKGQIKEIGWADVGGWTGQGGSILGTK
RTLPGKSLEAIAEQMRTHSINALLIIGGFEAYLGLLELAAAREKYEELRVPMVTVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQANVEHLTEKMKTTIQRGLVLRNESCSEHYTTDFIYHLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISTKLKEAQGKGKRFMTDDCICVL
GISKRNLLFQPVAQLKKETDFEHRIPKEQWWLKLRPLMKILAKYKASYEVSDPGQLEHVH
HRGHEEPAAI
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgacgacgtctccgcccgcaagggctccttccgaaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgcccaaggtatgaat
gctgctgtccgtgctgtggtgcgcatgggaatatacgtgggggccaaggtgtactttatc
tatgagggttaccaaggcatggttgatggcggcagtaacatcatggaagccaactgggaa
agcgtctccagcattctgcaagtgggaggcaccatcataggcagcgctcgctgcaaggcc
ttccgcacccgggagggtcggctgaaagccgctgggaacctggttcagcggggcatcacc
aacctgtgtgtgatcggcggggacggaagtctcaccggggccaacatcttccggaaggag
tggagcgggctgctccaagagctggccgaaaatggcgacatcgacagggaggaggtgcag
aagcacgcctacctcaacgtcgtgggcatggttggctccatcgacaacgacttctgcggc
actgacatgaccatcggcaccgactccgccttgcacaggattatcgaggtcgtggacgcc
atcatgaccaccgcccagagccaccagaggacctttgtgcttgaggtcatggggagacac
tgcgggtacctagcgctggtgagcgccctggcctgcggggcagactgggtgttccttcca
gaatctcccccggaagaaggctggcaggagaagatgtgtgtcaagctctcggagaaccgt
gcccggaagaaaagactgaatatcatcattgtggcagaaggtgccatcgacacccaaaat
aaacccattacctctgagcaaatcaaggagcttgtggtcacgcagctggggtacgacacg
cgggtgaccatccttggacacgtgcagagaggcgggactccttcggcctttgacaggatt
ttggccagtcgcatgggggtggaggccgtggtcgcccttctccaggccaccccagagacc
ccggcctgtgtggtgtcgctgagcgggaaccaggccgtccgcctgcccctggtggagtgt
gtgcagatgacccaggacgtgcagaaggccatggacgagaggagatttaaggacgccgtg
cgactccgcggaaggagcttcgagagcaatctgaacacctacaagcggctcgccatcaag
atgccagatgaccagatcccaaagagcaactgcaacgtggcagtcatcaacgtgggcgcc
cccgccgccgggatgaacgcggccgtgcgctcggccgtgcgcgtgggcatctccgaaggg
cacaagatgtttgccatctacgacggcttcgagggcttcgccaagggccagataaaggag
atcggctgggcggatgtcggaggctggaccggccaaggaggctccattcttgggaccaaa
cggacgctgcccgggaagtccctggaggcgatcgccgagcagatgcggacccacagcatc
aacgcgctgttgatcattggtggatttgaggcctacctgggactgctggaactggcagcg
gcccgggagaagtatgaggagctccgtgtccccatggtcacggtccccgccacggtgtcc
aacaacgtgccgggctccgacttcagcatcggtgcggacaccgccctgaacaccatcacc
gacacgtgtgaccgcatcaagcagtcggccagcgggaccaagcgccgcgtgttcatcatc
gagaccatggggggctactgcggctacctggccaacatgggggggctcgctgccggagcc
gacgccgcctacatcttcgaagagcccttcgacatccgcgatctgcaggccaacgtggag
cacctgaccgagaaaatgaagaccaccatccagaggggactcgtgctcaggaacgagagc
tgcagcgagcactacaccacggacttcatctaccacctctactccgaggagggcaagggc
gtgttcgactgcaggaagaacgtgctgggccacatgcagcagggtggagcgccttcaccg
tttgacagaaactttggaaccaagatctccgccagagccatgcagtggatcagcacaaag
ctaaaggaggctcagggcaaaggaaaaaggtttatgaccgatgattgcatttgcgtgctg
ggaataagcaaaagaaacctccttttccaacctgtggcacaactgaagaaggaaacagac
tttgagcaccggatccccaaggagcagtggtggctgaagctgcggccgctcatgaagatc
ctggccaagtacaaggccagctacgaggtgtccgaccccggccagctggagcacgtgcac
caccgaggccacgaggagcctgccgccatctag

DBGET integrated database retrieval system