KEGG   Acinonyx jubatus (cheetah): 106978021
Entry
106978021         CDS       T04657                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju03420  Nucleotide excision repair
aju04115  p53 signaling pathway
aju04120  Ubiquitin mediated proteolysis
aju05161  Hepatitis B
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05218  Melanoma
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106978021 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    106978021 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106978021 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106978021 (DDB2)
   05202 Transcriptional misregulation in cancer
    106978021 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106978021 (DDB2)
   05212 Pancreatic cancer
    106978021 (DDB2)
   05225 Hepatocellular carcinoma
    106978021 (DDB2)
   05226 Gastric cancer
    106978021 (DDB2)
   05214 Glioma
    106978021 (DDB2)
   05216 Thyroid cancer
    106978021 (DDB2)
   05220 Chronic myeloid leukemia
    106978021 (DDB2)
   05217 Basal cell carcinoma
    106978021 (DDB2)
   05218 Melanoma
    106978021 (DDB2)
   05213 Endometrial cancer
    106978021 (DDB2)
   05224 Breast cancer
    106978021 (DDB2)
   05222 Small cell lung cancer
    106978021 (DDB2)
   05223 Non-small cell lung cancer
    106978021 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    106978021 (DDB2)
   05169 Epstein-Barr virus infection
    106978021 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aju04121]
    106978021 (DDB2)
   03400 DNA repair and recombination proteins [BR:aju03400]
    106978021 (DDB2)
Ubiquitin system [BR:aju04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     106978021 (DDB2)
DNA repair and recombination proteins [BR:aju03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      106978021 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 106978021
NCBI-ProteinID: XP_026928551
UniProt: A0A6J2AFG6
LinkDB
Position
Unknown
AA seq 484 aa
MRRPLHSAAPIPVPARSWGTVPFRTEDAMAPRKRPETQKTPEVVVRPKTRRSRSPGELEP
EAKKLCVKGPGSSRRFDSGCLWAGLASLQVPPSYTSIVRALHHHKLGKAAWPSLQQGLQQ
SFVHSLASYRIFQKAAPFDRRATSLAWHPTHPSTLAVGSKGGDIMLWNFGIKDKPTFIKG
IGAGGSVTGLKFNPLDTNQFFTSSMEGTTRLQDFKGNTLRVFTSSDTCNIWFCSLDVSTR
SRMVVTGDNVGHVILLNMDGRELWNLRMHKKKVTHVALNPCCDWLLATASVDQTVKIWDL
RQVKGKSSCLHSLLHSHPVNAACFSPDGAQLLTTDQKSELRVYSASQWDCPPSLIPHPHR
HFQHLTPIKPSLSPCCSALKLQFLLTSALLMTSPVSAPKATWHPRYNLIVVGRYPDPNFK
SCTPHELRTIDVFDGSSGKMMYQLYDPESSGIISLNEFNPMGDTLASLMGYHILIWSQEA
GMRK
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgagacgcccgctccactcggcggcacctattcctgtccccgcacggagttggggcaca
gtaccctttcgcacggaggacgcgatggctcccaggaaacgcccagaaacccagaagacc
cccgaggtggttgtgcgccccaagaccaggaggagcagaagccccggggagctggagccc
gaggccaagaagctctgtgtgaagggccccggttctagcagaagatttgactcaggctgc
ctttgggcggggttggctagccttcaggtcccgccatcatacaccagcatcgtcagggcc
cttcaccaccataagctgggcaaagctgcctggccatcactacagcagggtctccagcag
tcctttgtgcactctctggcttcttaccggatattccaaaaggctgccccttttgacagg
agggccacatccttggcatggcacccaactcaccccagcaccctggctgtgggttccaaa
gggggagatatcatgctctggaactttggcataaaggacaaacccaccttcattaaaggg
attggagctggagggagcgtcactgggctgaagtttaaccctcttgataccaaccagttt
ttcacctcctcaatggagggaacaactaggctgcaagactttaaaggcaacacgctccga
gtgtttaccagctcagacacctgcaacatctggttttgcagcctggatgtgtctaccaga
agccgaatggtggtcacaggcgacaatgtgggacatgtgatcctgctgaacatggacggc
agggagctttggaatctgagaatgcacaaaaagaaagtgacccatgtggctctgaaccca
tgctgtgattggctcctggccacagcctctgtggaccaaacagtgaaaatctgggacctg
cgccaggttaaagggaaatccagctgcctccactcgctgctgcatagccatcctgtcaac
gcagcttgtttcagtcctgacggagcccagctcctgaccactgaccagaagagtgagctc
cgggtttactcggcctcccagtgggactgccccccgagcctgatcccacaccctcaccgc
cacttccagcacctgacgcccatcaagcccagcctatctccctgctgttctgccctcaaa
cttcagttcctgctgacctcagccttgctaatgacttctccagtctcagcccccaaggca
acctggcatcctcggtacaacctcattgttgtgggccgatacccagatcctaatttcaaa
agttgtaccccccatgaattaaggaccattgatgtgtttgatggaagctcagggaagatg
atgtatcagctctatgacccagaatcttctggtatcatttcgctcaatgagttcaatccc
atgggggacacgctggcctctctgatgggttatcacattctcatttggagccaggaagct
gggatgcggaaatga

DBGET integrated database retrieval system