KEGG   Acinonyx jubatus (cheetah): 106978669Help
Entry
106978669         CDS       T04657                                 

Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04614  Renin-angiotensin system
aju04924  Renin secretion
aju05142  Chagas disease (American trypanosomiasis)
aju05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    106978669
   04614 Renin-angiotensin system
    106978669
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    106978669
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    106978669
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aju01002]
    106978669
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106978669
   04090 CD molecules [BR:aju04090]
    106978669
Enzymes [BR:aju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106978669
Peptidases [BR:aju01002]
 Metallo Peptidases
  Family M2
   106978669
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106978669
CD molecules [BR:aju04090]
 Proteins
  106978669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 106978669
NCBI-ProteinID: XP_026903801
LinkDB All DBs
Position
Unknown
AA seq 1316 aa AA seqDB search
MGAASGRPRRGPLPPLPLLLLLLPPLPLLLPPPPAALALDPELHPGNFSADEAGAQLFVK
SFNSSAELVMYQSTVASWEYDTNITEENARLQEEAALLNQEFAEIWGQKAKDLYDPIWQN
FSDPILRRVISGVRTLGPANLPVAKRQQYNSLLSNMNRIYSTAKVCYYPNKTAICWSLDP
ELTHIMAISRSYSVLLYAWEGWHNAVGIPLKPLYQNFTALSNEAYKQDGFSDTGAYWRSW
YDSPTFVEDLEHLYHQVEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSW
DNLYDMVVPFPNKPSLDVTSTMVKKGWNITHMFRVAEEFFTSLGLLPMPPEFWTRSMLEK
PTDGRQVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQPVSLRQ
GANPGFHEAIGDVLALSVSTPEHLYKIGLLDNVSNDMESDINYLLKMALEKIAFLPFGYL
VDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICAPIARNETHFDAGAKFHVPNVTPYIRY
FVSFVLQFQFHQALCKEAGHQGPLHKCDIYQSTQAGAKLREALRSGSSRPWQEVLKEAIG
SDTLDAQPLLNYFQPVSRWLQEQNQRNGEVLGWPEYQWRPPVPHNYPQDIGLVTDEVEAR
KFVEEYDRRSQVIWNEYAEANWNYNTNITTEASKILLQKNIQMANHTLKFGTWARQFDMT
SFQNDSIKRMMKKIQDLERAALPAKELEEYNQILLDMETTYSVASVCHANGTCLQLEPDL
TNLMATSRKYEDLLWAWKSWRDKVGRAILPFFPKYVELANKAAKLNGYEDAGDSWRAMYE
MPTLEHDLEQLYQELQPLYLNLHAYVRRALHRHYGPQNINLEGPIPAHLLGNMWAQTWSN
IYDLVVPFPSAPKIDATEAMIKQGWTPRRMFEEADNFFTSLGLLPVPFEFWNKSMLEKPT
DGREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGA
NPGFHEAIGDVLALSVSTPKHLHSINLLSSEGGGYEQDINFLMKMALDKIAFVPFSYLVD
QWRWRVFDGSITKENYNQEWWNLRLKYQGLCPPVARAQGDFDPGAKFHVPSSVPYIRYFV
GFVIQFQFHEALCQAAGHKGPLHTCDIYQSKEAGKRLADAMKLGFSKPWPEAMKLITGQT
NMSASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPNSAHSEGPVPGNGRVNFLGLDL
EEQQARVGQWVLLFLGVTLLVATLVLTQRLFSIRRHSLHQPHHGPQFGSEVELRHS
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggccgtccccggcgggggccgctgccgccgctgccgctgctgctg
ctgctgctgccgccgctgccgctgctgctgccgccgccgcccgccgccctggcgctcgac
cccgagctgcatcccggaaacttttccgccgacgaggccggggcgcagctcttcgtgaag
agcttcaactcgagcgccgagctggtgatgtaccagagcacggtcgccagctgggagtac
gacaccaacatcaccgaggagaacgcgcggctccaggaggaagcagccctgctcaaccag
gagtttgctgagatctggggccagaaggctaaggacctgtatgacccaatctggcagaac
ttcagtgacccgatcctgcgaagggtcatcagtggtgtgcgcaccctgggccctgccaac
ctgcctgtggcaaagcggcagcagtacaactctctgctaagcaacatgaacaggatctat
tccacggccaaggtctgctactatcccaacaagactgccatctgctggtccctggaccca
gagctcacccacatcatggctatatcaagaagctactccgtgctgctctatgcctgggag
ggctggcacaatgctgtgggcatcccgctgaaacccctgtaccagaacttcactgccctc
agcaatgaggcctacaagcaggatggcttctcagacacgggggcctactggcgctcctgg
tatgactcacccaccttcgtggaggatctggaacacctctaccatcaagtagagcccctc
tacctgaacctccatgcctatgtccgccgtgcgctgcaccgccgatatggggacagatac
atcaacctcaggggacccatccctgctcacctgctgggggacatgtgggcccagagctgg
gacaacctctatgatatggtggtgccttttcctaacaagcccagtctcgacgtgaccagc
actatggtgaagaagggctggaacattacgcacatgttccgagtggcagaggaattcttc
acctccctggggctcttgcccatgcctcctgagttttggacaaggtccatgctggagaaa
cctactgacgggcgtcaggtggtgtgccacgcctctgcctgggacttctacaacaggaaa
gacttcaggatcaagcagtgcacgcgggtcactatggaccagctgtccacggtgcaccac
gagatgggccacgtgcagtactatctgcagtacaaggaccagcctgtctccctgcgccaa
ggggccaaccctggcttccacgaggccatcggggatgtgctggcgctctccgtctccact
cctgaacatctgtacaaaattggcctgctggacaatgtcagcaatgacatggaaagtgac
atcaattacttgttaaagatggcactggaaaaaattgccttcctgccctttggctacttg
gtggaccagtggcgctggggggtctttagtgggcgaacccccccttcccgctacaacttt
gactggtggtatcttcgaaccaagtatcagggaatctgtgctccaattgcccgaaatgaa
acgcactttgatgccggagctaagtttcatgtcccaaatgtaacaccgtacatcaggtac
tttgtgagttttgtgctgcaattccagttccatcaagccctgtgcaaggaggcgggtcac
caaggccccctgcacaagtgcgacatctaccagtccacccaggcgggggccaagctcagg
gaggcgctgcggtcaggctcctcacggccatggcaggaggtgctaaaggaggcgattggc
tcagatacactggatgctcaacctctgctcaactacttccagccggtcagccggtggctg
caggagcagaatcagcgcaacggcgaagtgctggggtggccggaataccagtggcggcca
ccagtaccccacaattacccacaggacattggcctggtgaccgatgaggtggaggctaga
aagtttgtggaggaatatgaccgaagatcccaggtgatatggaatgagtatgctgaggct
aactggaactataacaccaacatcaccacagaggccagcaagatcctgctacagaagaac
atacagatggcaaaccacaccttgaagttcggcacctgggccaggcagtttgatatgaca
agcttccagaatgacagcattaagcggatgatgaagaagattcaggacctagagcgggca
gcactgcctgccaaggagctggaggagtacaaccagatcctgctggacatggaaaccact
tacagcgtggcctctgtgtgccatgccaatggcacttgtctgcagctggagcctgatctg
acgaatctgatggccacgtcccggaaatatgaagatctgttgtgggcctggaagagctgg
cgagacaaagtggggagagcaatcctcccctttttccccaaatatgtggaacttgccaac
aaggccgccaagctcaatggctacgaagatgcaggtgactcctggagagccatgtacgag
atgccaaccctggaacacgacctggagcagctctaccaggagctgcagccgctctacctg
aacctgcacgcctacgtgcgccgggccctgcaccgccactatgggccccaaaacatcaac
ctggagggccccattccagctcacctgctggggaacatgtgggctcagacttggtccaac
atctatgacttggtggtgcctttcccttcagcccccaagatagatgccacagaggccatg
ataaagcagggctggacacccagaaggatgtttgaggaagcggacaatttcttcacctcc
ctggggctgttgcctgtgccctttgagttctggaacaagtcaatgctagaaaagccgact
gacgggcgggaagtagtgtgccacgcctctgcctgggacttctacaatggcaaggacttc
aggatcaagcagtgcaccactgtgaacatggaggacctggtggtggcccatcatgaaatg
ggccacatacagtatttcatgcagtacaaggacttgcctgtgaccttccgggagggtgcc
aaccctggctttcacgaggccattggagatgtgctggccctctcagtgtctacccccaag
cacctccacagtatcaacctgctgagtagcgagggtggcggctatgagcaagacatcaat
tttctgatgaagatggcactcgacaagatcgcctttgtccccttcagctacctcgtcgac
cagtggcgctggagggtatttgatggaagcatcaccaaggagaactacaaccaagagtgg
tggaacctcaggctaaagtaccagggcctctgccccccagtggcccgggctcaaggggac
tttgacccaggggccaagttccacgttccttcaagtgtgccttatatcaggtactttgtc
ggctttgtcattcagttccagttccacgaggctctgtgtcaggcagctggccacaagggc
cccttgcacacatgtgacatctaccagtctaaggaggcaggaaagcgcctggcggatgcc
atgaaactgggcttcagtaagccatggccagaagccatgaagctgatcacaggccagacc
aacatgtctgcgtccgccatgatgaactacttcaagccgctgctagactggcttctcact
gaaaatgggcggcacggggagaagctgggctggcctcagtacaactggacaccaaactct
gctcactcagaaggccccgtcccgggcaatggccgtgtcaacttcctgggcctggacctg
gaggagcagcaggcccgcgtgggccagtgggtgctgctcttcctgggcgtaaccctgctg
gtggccaccttggtcctcacccagcggctcttcagcatccgccgtcacagcctccaccag
ccccaccatgggccccagtttggctccgaggtggagctgaggcactcctga

DBGET integrated database retrieval system