KEGG   Acinonyx jubatus (cheetah): 106978896
Entry
106978896         CDS       T04657                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106978896 (PMAIP1)
   04215 Apoptosis - multiple species
    106978896 (PMAIP1)
   04115 p53 signaling pathway
    106978896 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106978896 (PMAIP1)
   05203 Viral carcinogenesis
    106978896 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106978896 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106978896 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1 Bclx_interact
Other DBs
NCBI-GeneID: 106978896
NCBI-ProteinID: XP_026924890
UniProt: A0A6J2A935
LinkDB
Position
Unknown
AA seq 54 aa
MPGKRTRKSAQPSPARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
NT seq 165 nt   +upstreamnt  +downstreamnt
atgcctgggaagaggacgcgtaagagcgcgcagccgagccccgcgcgggccccggcagag
cccgaagtggaatgtgccatgcagctccggagatttggagacaaactgaatttccgacag
aagcttatgaatctgatatccaaactcttccgctcgggaacctga

DBGET integrated database retrieval system