KEGG   Acinonyx jubatus (cheetah): 106979084Help
Entry
106979084         CDS       T04657                                 

Gene name
SETD1A
Definition
(RefSeq) SET domain containing 1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106979084 (SETD1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106979084 (SETD1A)
Enzymes [BR:aju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106979084 (SETD1A)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106979084 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     106979084 (SETD1A)
    COMPASS/SET1 complex (yeast)
     106979084 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET N-SET RRM_1 Topoisom_I_N Macoilin
Motif
Other DBs
NCBI-GeneID: 106979084
NCBI-ProteinID: XP_014932327
LinkDB All DBs
Position
Un
AA seq 1405 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTESRRRSSSDTAAYPAGSAGVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSTAASATTAATASSSCSSSSSSSLSSSSSSSSSSSSS
HFRGTDSNYPAYYESWNRYQRHASYPPRRATREEPPGASFAENAAERFPPSYTSYLPPEP
SRPADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEAWLPPRPASPARSGSPAPETTN
ESVPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSTTGPGSRDIGSEVPSGSGHG
PCTPPPAPANFEDVAPTGSGEPGVTRESPKANGQNQASPCSSGEDMEISDDDRGISPPLA
PTPPQQPPPPPPPPPPPPPYLASLPLSYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIY
DFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLQQGKGLTAASAGPPGGAFGEAFLP
FPPPQEAAYGLPYALYTQGQEGRGAYSREAYHLPLPVAAEPLPSSSVSGEEARLPPREEA
ELAEGKALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPF
QNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKR
KEPSEISEASEEKRPRPSTPAEEDEDATHMHLDPEREKEAGEPGRPGTKPPKRDEERSKT
QGKHRKSFALDSEGEEASQESSSEKDEEDDEEDEDDEEREEAMDTTKKETEASDGEDGES
DSSSKCSLYADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSSESSSEEEEEEEQP
ATIPSTSPPPRDVPAPLPAPVEEPEPERVAGSPVTPVPEQEKSPARPVGSTEEPPPSVPQ
PPPEPPRLLQQTSGADWLNDTHWVHHTITNLSTPKRKRRPQDGPREHQTGSARSEGYYPI
SKKEKDRYLDVCPVSARQLEGADTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLKLNQ
LKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSS
YLFRVDHDTITKATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITY
DYKFPLEDNKIPCLCGTESCRGSLN
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaagccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccttgcgcaggccttctcaaaaggtgtac
cgctatgatggagtccacttcagtgtcaacgactcaaaatacataccagtcgaagacctc
caagacccccgatgccacgtcaggtccaaaaacagagacttttccctcccagtccctaag
tttaagctggatgagttctatatcggacagatccctctgaaggaagtgactttcgcgagg
ctgaatgacaatgtgcgggagaccttcttaaaggatatgtgccgaaagtatggtgaggtg
gaagaggtagagatccttcttcacccccgtactcgcaagcacctgggcctggcccgcgtg
ctcttcactagcactcggggagccaaggaaacagtcaaaaacctccaccttacctccgtc
atgggcaacatcatccacgcccagctcgacatcaaaggacaacaacgaatgaaatactat
gaactgatagtcaatggctcctacacccctcagacggtgcccactgggggcaaggcgctg
agcgagaagttccagggctctggtgcagccactgagacgactgaatcccgccgccgctcc
tcctctgacacggctgcttacccggcaggctctgctggggtgggcactcctggcaatggc
accccctgctcccaggacacaagcttctccagcagccgacaagacaccccatcttccttt
ggccaattcacccctcagtcctcccaaggaaccccttacacatctcggggcagcaccccc
tactctcaggactctgcctactccagcagcaccacttcaacctccttcaagcctcggcgg
tcagagaacagctaccaagattctttttcccgccgccatttctctgcatcttcagccccc
acgaccacctctacagctgcctccgccactactgcagccactgcctcgtcctcctgctca
tcttcctcctcttcttcgttgtcctcgtcctcttcatcctcctcttcgtcctcatcctct
cattttcgtggtactgactcaaactacccagcgtattatgaaagctggaatcgctaccaa
cgccatgcttcctaccctccccgccgcgcaactcgggaggagccccctggggcatctttt
gctgaaaatgcagctgagcgcttcccaccttcctacacctcctacttgccccctgagccc
agccggcctgctgaccaggactaccggcctcctgcctcagaagctccacccccggagcct
ccagaacctggtggaggcgggggggggggggggcccagccctgagagagaagaagcatgg
ctccccccccgcccagcctcacctgcccgctccggctccccagccccagagaccaccaat
gagagtgtgcccttcgctcagcatagcagcttggattcccgcattgagatgttgctgaag
gagcagcgctccaagttttcgttcctggcctctgacacagaggaagaggaagagaacagt
accacaggccctgggtctagagacatagggagtgaggtgccttctgggtcaggtcatggg
ccctgcacgccccctccagccccagctaattttgaggatgtggcacctacagggagtggg
gaaccaggggttacccgggagtctcccaaggccaacggacagaaccaggcttctccgtgc
tcttcgggagaggatatggagatctctgatgatgacaggggcatttccccccctctggcc
ccaacacctccccagcagcctccaccccctcctccaccaccccctcctcctcctccctac
ctggcttccctccccctttcttatcctccccaccagcctgcctacctcctcccaccacgc
cctgatgggccaccaccccctgagtaccccccacctcctccgccacctccccacatttat
gactttgtgaattccctagagctcatggatcgacttggggctcagtggggagggatgccc
atgtccttccagatgcagacccagatgttaactcggctccatcagctgcagcagggcaag
ggattgactgctgcctcagctggcccccctggtggggcttttggggaggccttcctccca
ttcccacccccccaagaggcagcctacggcttaccctacgctctgtacacacaagggcaa
gaaggccgaggggcatactcccgggaggcataccacctgcctttgcccgtggcagctgag
cccctgccctcctcctcggtctctggagaagaggcccggctacctcccagggaggaagca
gagctggcagagggcaaggccctaccgtcagcaggcaccgtggggcgtgtgctggccacc
ctagtccaagagatgaagagcatcatgcagcgagacctcaaccgcaagatggtggagaat
gtggcctttggagcctttgaccagtggtgggagagcaaggaagagaaggccaagccattc
cagaacgcagccaaacagcaagccaaggaggaggataaagagaagacaaaactcaaagag
ccaggcctgctgtccctcgtagactgggccaagagtgggggtaccacgggcatcgaggcc
ttcgcttttgggtcagggctgcgaggggccctgcggctgccttctttcaaggtaaagcga
aaagagccttcggaaatttcagaggccagtgaggaaaagaggccccggccctccactcca
gctgaggaggatgaagatgccactcacatgcacctagaccctgagcgagagaaggaggct
ggagagccgggacgtccgggaaccaagcccccaaaacgagatgaagagcgaagcaagacc
cagggcaagcaccgcaaatcctttgctctggacagtgagggggaggaagcatcccaggag
tcctcctcagagaaggatgaggaggatgatgaggaagatgaagatgatgaagaacgtgag
gaagccatggatactacaaagaaggagacagaggcatcagatggcgaggacggggaaagc
gattcgtcctccaaatgttctctgtatgccgactcagatggtgaaaatgatagcacgtca
gactccgagagcagcagctcatccagctcgtcatcgtcctcatcttcctcctcctcatcc
tcctcatcctcctcatcatctgagtcctcctctgaagaagaagaggaagaggagcagcca
gcaaccataccctcaacgtcccctccccccagagatgtccctgcgcccctgccagcgcct
gtggaagagcctgagccagagcgggttgcaggctccccagtcacacctgtccctgaacag
gagaagtctccggcaagacctgtaggttccaccgaggaaccacctcccagtgtgccccag
cctccccctgagcccccacggctactgcagcagacaagcggggctgactggcttaacgac
acccactgggtccatcacaccatcaccaacctgagcactccaaaacgcaagcggcggccc
caggatgggccccgtgagcaccagacaggctcagcccgaagtgaaggctattaccccatc
agcaagaaggaaaaagacaggtacctggatgtgtgtcctgtttctgcccggcagctagaa
ggagcggacactcaggggactaaccgtgtgctttcggagcgccggtctgagcagcggcgg
ctgctgagtgccattggcacctctgccatcatggacagtgatctgctaaagctaaaccag
ctcaagttccggaagaagaagctccgattcggccggagccggatccatgagtggggactg
tttgccatggaacccatcgcagctgacgagatggtcatcgaatacgtgggtcagaacatc
cgccagatggtggccgacatgcgggagaagcgctacgtgcaggaaggcatcggcagcagc
tacctgttccgggtggaccatgacaccatcaccaaagccaccaagtgcggcaacctggcg
aggttcatcaaccactgctgcacgcccaactgctatgccaaggtgatcaccatcgagtcc
cagaagaagattgtgatttactccaagcagcccattggtgtggatgaggagatcacctat
gactacaagttcccgctggaggacaacaagatcccatgtctgtgtggcaccgagagctgc
cgtggctccctcaactga

DBGET integrated database retrieval system