KEGG   Acinonyx jubatus (cheetah): 106979265
Entry
106979265         CDS       T04657                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04014  Ras signaling pathway
aju04390  Hippo signaling pathway
aju04392  Hippo signaling pathway - multiple species
aju05200  Pathways in cancer
aju05206  MicroRNAs in cancer
aju05219  Bladder cancer
aju05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106979265 (RASSF1)
   04390 Hippo signaling pathway
    106979265 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    106979265 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106979265 (RASSF1)
   05206 MicroRNAs in cancer
    106979265 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    106979265 (RASSF1)
   05223 Non-small cell lung cancer
    106979265 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 106979265
NCBI-ProteinID: XP_026894606
UniProt: A0A6J1XQ01
LinkDB
Position
Unknown
AA seq 425 aa
MRGEKEKEGGDSARACPTPRPRRPIPPVGRHGRSAQVSFAPLAPVLSRRPAGIPGAAPNR
GPPRGPARPALARADSRRESGRDPAMSTKPELIELRELEPARRAGPGRTRLERANALRIA
PGTARNPARQLVAGRGHHFQPAGPATHTWCDLCGDFILGVVRKGLQCAHCKFTCHYRCRA
LISLDCCGPRDLGWEPALERDTNVDEPVEWETPDLSQAETEQKIKEYNSQINSNLFMSLN
KDGSYTGFIKVQLKLVRPVSVPSSKRPPSLQAAQRGPGRGTAVRRRTSFYLPKDAVKHLH
VLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPS
EKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALH
ACPLG
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcgtggagaaaaggaaaaggagggcggggactctgcgagagcgtgcccaaccccgcgc
cctcgccgccccattccgcctgtgggccgacacggccggagcgcccaggtttcctttgca
ccgctcgccccggttctctcccgccgccctgccgggatcccgggggcggcgccgaatcgg
ggtccgccccgcggccccgcccgccccgcgctcgctcgcgccgacagccggcgggagtcc
gggcgcgacccggccatgtccacgaaacctgagctcattgaactgagggaactggaaccc
gcgcggcgcgcgggccccggccgcacccggctggagcgtgccaacgcgctgcgcatcgcg
ccgggcaccgcgcgtaatccggcacggcagctggtcgcgggccgcggccaccacttccag
cccgcggggcctgccacacacacgtggtgcgacctctgcggcgacttcatcttgggcgtc
gtgcgcaagggcctgcagtgcgcgcattgcaagttcacctgccactaccgttgccgcgcg
ctcatcagcctggactgctgcgggccccgggacctgggctgggaacctgcgctggagcgg
gacaccaacgtggacgagcctgtggagtgggagacacctgacctttctcaggctgagact
gagcagaagatcaaggagtacaatagccagatcaacagcaacctcttcatgagcctgaac
aaggatggctcctacacaggcttcatcaaggttcaactgaagctggtgcgccctgtctcg
gtgccctccagcaagaggccaccctccttgcaggctgcccagcggggcccaggacggggc
acagctgtgaggcgccgcacctccttctacttgcccaaagatgccgtcaagcacctgcat
gtgttgtcacgcacacgggcacgcgaggtcattgaggccctactgcgcaagttcttagtg
gtggatgacccccgcaagtttgcactctttgagcgggctgaacgccatggccaagtgtac
ctccggaagctatcagatgatgagcaacccctgcggctgcggctccttgcagggcccagc
gagaaggccctaagctttgtcctcaaagagaatgattctggggaggtaaattgggatgcc
tttagcatgcctgagctacacaacttcttgcgcatcctgcagcgggaggaagaggaacac
ctccgccaaatcctgcaaaagtactcctattgccgtcagaagatccaggaggccctgcac
gcctgccccctggggtga

DBGET integrated database retrieval system