KEGG   Acinonyx jubatus (cheetah): 106979518Help
Entry
106979518         CDS       T04657                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00512  Mucin type O-glycan biosynthesis
aju01100  Metabolic pathways
Module
aju_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    106979518 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aju01003]
    106979518 (GALNT9)
Enzymes [BR:aju01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     106979518 (GALNT9)
Glycosyltransferases [BR:aju01003]
 O-Glycan biosynthesis
  Mucin-type
   106979518 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 106979518
NCBI-ProteinID: XP_026907900
LinkDB All DBs
Position
Unknown
AA seq 592 aa AA seqDB search
MGCAERCPMYGSRQCVRLSQLTQVWVADRGFAKFGLKERGRQRRLGAGAGGHGGPGAWLT
ALLSRFPPGLAKPIGLVEGPGGLGQGGMAATLREDSQETESKYEEYGYNAQLSDRISLDR
TIPDYRPKKCRQVTHTADLPQISVVFIFVNEALSVILRSVHSVVNRTPSRLLKEVILVDD
NSDSVELKTSLDQYVNRRYPGLVKIVRNSRREGLIRARLQGWKAATAPVVGFFDAHVEFG
TGWAEPALTRIQEDRRRIVLPAIDNIKYDTFEVQQYASAAHGYNWGLWCMYIIPPQDWLD
RGDEAAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMRVWQCGGSMEVLP
CSRVAHIERSKKPYNNDIDYYAKRNALRAAEVWMDSFKSHVYMAWNIPMTNPGVDFGDVS
ERLALRQRLKCRSFKWYLENVYPEMRTYNDTLTYGEVRNSKASGYCLDQGAEDDDHAILY
PCHGMSSQLVRYSAEGLLQLGPLGSTAFLPDSKCLVDDGRSRVPALKTCEDVARPAQRLW
DFTQSGPIVSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWTIRSWLKRGRH
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgctgagcgctgtccgatgtacggctcccgtcagtgtgtccggttgtcccag
ctgacgcaggtctgggtggcagaccgggggtttgccaagttcggcctgaaagaaaggggc
cgccagcggaggctgggggcgggcgcgggagggcacgggggtcccggggcctggctgacc
gccctcctttcccgtttcccgccaggcctcgccaagcccatcggcctggtggaggggcct
gggggcctgggccagggcggcatggcggccaccctgcgtgaggacagccaggagacagaa
agcaaatacgaggaatacgggtacaacgcgcagctcagcgaccgcatctccctggacagg
accatcccggactacaggcccaaaaagtgcagacaggtgacccacaccgccgacctgccc
cagatctctgtggtcttcatcttcgtcaacgaggccctctccgtcatcctgcgctccgtg
cacagcgtggtcaaccgcacgccctcgcggctcctcaaggaggtcatcctggtggacgac
aacagtgacagcgtggagctcaagaccagtctggaccagtacgtcaacaggaggtacccg
ggcctggtgaagatcgttcgcaacagccggcgggaaggcttgatccgggcacggctgcag
ggctggaaggcggccacggcccccgtggtcggcttcttcgacgcccacgtggagttcggc
acgggctgggccgagcccgcgctcacgcggatccaggaggaccgccggcgcatcgtcctg
cccgccatcgacaacatcaagtacgacacgttcgaggtacagcagtatgccagcgcggcc
cacggctacaactggggcctctggtgcatgtacatcatccccccccaggactggctggac
cgtggcgacgaggcggcgcccatcaggacccccgcgatgattggctgctcgttcgtggtg
gaccgggagtactttggggacatcggcctgctggacccgggcatggaggtgtatggtgga
gagaacatcgagctgggcatgagggtgtggcagtgtggcggcagcatggaggtgctcccc
tgctcccgcgtggcccacatcgagcgcagcaagaagccctacaacaacgacatcgactac
tacgccaagcgcaacgccctgcgggcagcggaggtgtggatggacagcttcaagtcccac
gtgtacatggcctggaacatccccatgaccaacccaggggtggacttcggggacgtgtct
gagcggctggcgcttcgccagaggctgaaatgccgcagcttcaagtggtacctagagaac
gtgtacccggagatgcggacctacaacgacaccctcacgtacggagaggtgagaaacagc
aaagccagtggctactgcctggaccagggagcggaagacgacgaccacgcgatcctctac
ccctgccacgggatgtcctctcagctggtgcgctacagcgctgaggggttgctgcagctg
ggccccctgggctccaccgccttcctgcccgactccaagtgcctggtggacgacggcagg
agccgcgtgcccgccctgaaaacgtgtgaggacgtggcccggccagcgcagcggctgtgg
gacttcacccagagcggccctattgtgagtcgagacacaggcaggtgcctggaggtggaa
atgtccaaggacgccaacttcgggctgcggctggtggtacagagatgctcggggcagaag
tggaccatcaggagctggctcaagcgcgggcgacactga

DBGET integrated database retrieval system