KEGG   Acinonyx jubatus (cheetah): 106979835Help
Entry
106979835         CDS       T04657                                 

Gene name
SETDB1
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETDB1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00310  Lysine degradation
aju04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106979835 (SETDB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    106979835 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106979835 (SETDB1)
Enzymes [BR:aju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106979835 (SETDB1)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106979835 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106979835 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF5604 Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 53-BP1_Tudor Chromo
Motif
Other DBs
NCBI-GeneID: 106979835
NCBI-ProteinID: XP_014933283
LinkDB All DBs
Position
Unknown
AA seq 1297 aa AA seqDB search
MSSIPGCIGLGAAAAAVESDEIAELQQAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGPLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPTEPPQPTAPPAPPAPPAPPAPPAPPVSPQAGD
NDSLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVPAGKPGSNQTYRSPLGP
TASAPAAPPAPPVPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSAQY
RGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLF
LEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPG
KGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECL
PTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAG
KILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSG
TEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETASKDSRPPDLGP
PHIPVPPAIPGGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGEGRA
GGGRGEAEKASTSGLGFKDEGDLKQAKKEDPDDRNKMSLITESSRNYGYNPSPMKLEGLR
RPPSKTSMHQSRRLMASAQSNADDVLTLSSSTESEGESGTSRKPTTGQTSATAVDSDDIQ
TISSGSEADDFEDKKNMSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPVR
KNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKR
IRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatccctgggtgcattggtttgggtgcagccgcagctgcggtggagtctgat
gagatcgcagagctgcaacaagcggtggttgaggagctgggtatctcaatggaggaactg
aggcagttcatcgatgaagaactggagaagatggactgtgtacagcagcgaaagaagcaa
ctagcggagttggagacgtgggtaatacagaaggaatctgaggtggcccatgttgatcag
ctctttgatgatgcatccagggcagtgactaactgtgagtctttggtgaaggacttttat
tccaaactgggactacaataccgggacagtagctctgaggatgaagcctcccggcctaca
gaaataatcgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaacacccaaagaccagaagctccgtgaggctatggctgccttaagaaagtca
gctcaagatgtccagaagttcatggatgctgtcaacaaaaagagcagctcccaagatcta
cataaaggaaccttgagtcagatgtctggagaactgagcaaagatggtgacctaatagtc
agcatgcgcatcctgggcaagaagagaactaagacatggcacaaaggcacccttattgcc
atccagacggtcggaccaggaaagaagtacaaggtgaaatttgacaacaaaggcaagagt
ctactgtcagggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgagtggtggccaagtacaaggatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggg
tacgcttcctatgtcacacaatctgaactgtatcccatttgccggccactgaaaaagaca
tgggaggacatagaagacatctcctgccgagacttcatagaggagtacatcacagcctac
cccaaccgccctatggtgctactcaagagtggccagcttatcaagactgagtgggaaggc
acatggtggaagtcccgggtcgaggaggtggacggcagcctagtcaggatcctcttcctg
gatgacaaaagatgcgaatggatctatcgaggctccacacggctagagcccatgttcagc
atgaagacctcctcagcctccgcactagagaagaagcaagggggaccgctcaggacacgt
ccaaatatgggtgctgtgaggagcaaaggccctgtggtccagtacacccaggatctgacc
agtactgggacccagttcaagccaacggagcccccacagcctacagccccccctgctccc
cctgccccgcctgctccccctgccccccctgctccccctgtgtccccgcaggcaggtgac
aatgacagcttggaaagtcagcttgcccaatctcggaagcaggtagccaaaaagagcaca
tccttccgaccaggatctgtgggctctggtcattcctcccctacatctcctgcactcagt
gaaaatgttcctgctgggaaacctgggagcaaccagacatatagatcacctttaggccca
acagcctctgccccagcagcgcccccagcacctcccgtgcccccagccttccatggcatg
ttagaacgggccccagcggagccctcctaccgtgcccccatggagaagctcttctattta
cctcatgtgtgcagctatacgtgtctgtctcgagttagacctatgagaagtgcacagtac
cggggcaagaacccactgctggtcccgctgctctatgacttccggcggatgacagcccgt
cgccgagttaaccgcaagatgggctttcacgtgatctataagacaccctgtggcctctgc
cttcggacaatgcaggagattgaacgctatctttttgagactggctgtgacttcctcttc
ctggagatgttctgtttggatccatatgttcttgtggaccgcaagtttcagccctataaa
cctttttactacattctggacatcacctatgggaaggaagatgtccccctatcctgtgtc
aatgagattgacacaacccccccaccccaggtggcctatagtaaggaacgaatccctggc
aagggtgttttcattaacacaggcccagaatttctggtcggctgtgactgcaaggatggg
tgccgtgacaagtccaagtgtgcctgtcatcagctaactatccaggccacagcctgtacc
ccgggcggccagatcaaccctaattctggctaccagtacaagagactagaagagtgtctg
cccacaggagtttatgagtgtaacaaacgttgtaaatgtgacccaaacatgtgcacaaac
cggttggtgcagcacggactccaggttcggctacagctattcaagacacagaacaagggc
tggggtattcgctgcttggatgacattgccaaaggatccttcgtctgtatttatgcaggc
aagatcctgacagatgactttgcggacaaggagggcctggagatgggtgatgagtacttt
gccaatctggaccatatcgagagtgtggagaacttcaaggaaggatatgagagtgatgcc
ccctgttcgtccgacagcagcggggtggacttgaaggaccaggaagatggcaacagcggt
acagaggatcccgaagagtccaatgacgacagttccgatgataacttctgtaaagatgag
gacttcagtaccagctctgtgtggcgcagctatgctacccggaggcagacccggggccaa
aaggagaacggactgtctgagacggcttccaaggactcccgccccccagacttgggcccc
ccccatattcctgtccctccagcgatccctgggggtggctgcaatccgccttcctctgaa
gagacacccaagaataaggtggcctcatggttgagctgcaatagtgtcagtgaaggtggc
tttgctgactctgatagccgttcatccttcaagactagtgaaggtggggaaggccgggct
gggggaggcagaggggaggctgagaaggcctccacctcagggctgggcttcaaggatgag
ggagatctcaagcaggccaagaaagaggaccctgatgaccgaaacaagatgtccttaatc
actgaaagctctcgaaattatggttacaatccttctcccatgaaacttgaaggacttcgc
cgcccacctagtaagactagtatgcatcagagccgacgactcatggcctctgctcagtcc
aacgctgatgatgtcttaacactgtccagcagcacagaaagcgagggggaaagtgggacc
agccggaagcctaccaccggccagacttcagccacagcagtggacagcgatgatatccag
accatctcctctggctctgaagcagatgactttgaggacaagaagaacatgtctggtcca
acaaagcgccaggtggcagtaaaatcaacccggggctttgctcttaagtcaacccatggg
attgccattaaatcaaccaacatggcatccgtggaaaagggggagagcgcacctgtccgt
aagaacacacgccagttctacgatggggaggagtcttgctacatcatcgacgccaagctc
gaaggcaacctgggccgctacctcaatcacagctgcagccccaacctgtttgtccagaat
gtctttgtggacactcacgatcttcgcttcccctgggtggccttctttgccagcaagagg
atccgggccgggactgagctgacttgggactacaactatgaggtgggcagtgtggaaggc
aaggagctgctgtgctgctgcggggccattgaatgcagggggcggcttctttag

DBGET integrated database retrieval system