KEGG   Acinonyx jubatus (cheetah): 106980942
Entry
106980942         CDS       T04657                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aju04131]
    106980942 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:aju04054]
    106980942 (NLRP4)
Membrane trafficking [BR:aju04131]
 Autophagy
  Other autophagy associated proteins
   Others
    106980942 (NLRP4)
Pattern recognition receptors [BR:aju04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   106980942 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 PIN_12 SprT-like AAA_16 AAA_25 Pox_L5
Other DBs
NCBI-GeneID: 106980942
NCBI-ProteinID: XP_026893049
UniProt: A0A6J1XKS7
LinkDB
Position
Unknown
AA seq 985 aa
MASSFFSDFGLMWYLEELKKDEFRKFKELLKQEPLKLGLKIIPWTEVKKATREDLANLLM
RHYKEQQAWNVTFSVFNKINRKDLCEKAKKEITGHTKLYQMHVKEKFNNMWLRESIPRIQ
DHLHPELTQRERECLELFFAPKETGKQTRTVLLKGIQGIGKTTFLIRLMLAWVEGNLYQE
RFSYVFYLCCREMKQLTETSLAALLSRGWSDSLTPFVEILSQPERLLFLIDSFEELKCSL
SEPESDLCSDCMEQVPVQVLLSSLLRRKLLPESSLLITATPVYPQEVEDRLECPEIRTLL
GFSDSDKKIYFCSMFQDRNRAMEAFSFMRENGHLFIMCQIPILCWIVSTCLKQEMEKGKD
LALTCRRTTSLYSSFIFNLFTPKGASCPDEQSQGQLKGLCSLAAEGMWTNMFLFSEGDLR
RNGLVDSDISTLLDIKVLQKCKEEENSYMFLHVSIQEFCAAMFYFLKSHMDHPNPAVGCR
KAVLFTYLKKEKVHWISLGCFIFGLLNEKEQQKLDTVFGFHLSQEIQQECHQHLQRIGEN
EHLQKQTDFLALCYCLFEMQNEGFVQWAMDFFQDVHFTITDHVDLQVSAYCLKYCSSLQK
LCFSTQNVFQVGNADSSVSSYNILCWHDICSVLTTNEHLRELQMSHSILSESTYVTLCNQ
LRHPSCHLQKLQMNNVTFAGDSWLFFEVLTHSPDLKYLNLSGTTLSCNDVKLLCNALNNP
MCNVEELLLANCHLSADDCEAFTCVLNSSKKLKLLNVSYNYLDQGVPLLCEALQRRDCGL
EGLILGYCYLTEHSWKYLYNVLLYNKSLTHLDLSANVLKYENLKLLCEALKQPGCHLWSL
CLVKCSITADGCRDLASVLTGNQNLRSLQISYNDIEDAGVKLLCQGLAHPSCHLEILGLA
TCKLTSACCEDLSSALTSSKTLKSLNLQGNALDHTGVAVLCEALRHPACTLQILGLQKTE
FDEETQRLLTVAEEENPSLTVIGDW
NT seq 2958 nt   +upstreamnt  +downstreamnt
atggcgtcatctttcttttctgattttggcctgatgtggtacctggaggagctcaaaaag
gatgagttcagaaaatttaaggagctcctaaaacaggagcctctgaagcttggactcaag
ataattccctggactgaagtaaagaaggcaacacgggaagatcttgcaaacctgctgatg
aggcattacaaggaacagcaagcatggaatgtgactttcagtgtctttaacaagatcaat
agaaaagatctctgtgagaaggcaaagaaagagatcacaggacacacaaagttgtaccaa
atgcacgtgaaggagaaattcaacaacatgtggctcagagaatctatccccaggattcaa
gatcacttacatcctgaactcacccagagagaacgtgaatgcttggaactgttttttgct
cctaaggaaactgggaaacagacacggacggtgctcctcaaaggaatacaagggattggg
aagacaacattcctgatcaggctgatgttggcctgggtggagggtaacctctaccaggag
agattctcctatgttttctacctctgctgccgggaaatgaagcagttgacagagaccagt
ttggctgcactcctctctagaggctggtctgactccttgactccttttgtggagatcctg
tcccaaccagagagactcttgtttctcatagacagcttcgaagaactgaaatgtagcctg
agtgaacctgagtcagatctgtgcagcgactgtatggagcaggtgccagtacaggtgctc
ctgagcagcttgctgaggaggaaattgctccccgagtcctcgctgctcatcactgctaca
cctgtgtacccccaggaagttgaggataggttggagtgcccagaaattagaacactcctg
ggattcagtgacagtgataagaagatctatttctgctctatgtttcaagaccggaataga
gccatggaagccttcagtttcatgagagaaaatgggcatttgtttatcatgtgccaaatc
cccatcctttgctggattgtgagcacttgtctgaagcaggaaatggaaaaggggaaagac
ctggcgctgacctgccgacgtaccacctctctttatagctctttcatctttaacttgttc
acgcccaagggggctagctgtccagatgagcaaagccaaggccagttgaagggcttgtgt
tccctggctgcagagggtatgtggaccaacatgtttttgttcagtgaaggggacctcagg
agaaatgggttagttgattctgacatctctacgttgctggacataaaggttcttcagaag
tgcaaggaggaggagaactcctacatgtttctccatgtgagcatccaggagttctgtgcc
gccatgttctattttctcaagagccacatggaccatcctaacccagctgttggatgtaga
aaggctgtgctatttacctatttgaagaaagaaaaggtacattggatttctttggggtgt
ttcatatttggccttttaaatgaaaaggaacaacaaaagctggatacagtttttggcttt
cacctgtcccaggagatacagcaggaatgtcaccagcacttgcagcgcataggtgagaat
gagcatcttcagaaacagacagatttcttggcattgtgttactgtctgtttgagatgcag
aatgaaggttttgtgcagtgggcaatggacttcttccaagatgttcactttaccatcacg
gaccacgtagacttgcaggtttctgcctactgcttaaaatactgttccagtttgcagaag
ctttgcttctccacccagaatgtctttcaagtgggaaatgcagacagctctgtgtcaagt
tacaatatcctctgttggcatgatatctgctctgtgctcactacaaatgagcacctcaga
gaactccaaatgagtcacagtatcctcagtgagtcaacctatgtaactttgtgtaatcag
ctgaggcatcccagctgtcaccttcaaaagcttcagatgaataatgttaccttcgctggt
gacagttggcttttctttgaggtgctcactcatagtccagatttgaaatacctgaacctc
agtggtacaacactctcgtgcaatgatgtgaagttgctctgtaatgccctgaacaatcca
atgtgcaatgtagaagaactactgctggcaaattgtcacctttcagcagatgattgtgaa
gcctttacctgtgtcctaaacagcagcaagaagctgaagcttcttaatgtatcctacaac
tacctggaccaaggggtacccctgctgtgtgaggccttgcagcgccgtgactgtggtcta
gagggcttgatattaggttactgttacctcactgaacactcctggaaatacctctacaac
gttcttctgtataacaaaagcttgacccatctagacctcagtgccaacgtcctgaaatat
gaaaacttgaaacttctctgtgaggccttgaagcagccaggctgccacctgtggtcactg
tgtttggtgaaatgttccatcaccgctgatggctgtcgagacctcgcctcagtcctcact
ggcaatcagaacttgagaagtctacaaatcagctacaatgacatagaagatgctggtgtg
aagctgctgtgtcaaggtctagcacatcccagctgtcacttagagattcttgggctggct
acatgcaagttaacaagtgcctgctgtgaggacctctctagtgccctcaccagcagtaaa
accctgaagagtctgaacctgcaaggaaacgccctggaccacaccggagtggcagtgcta
tgtgaagccctgagacacccagcgtgcaccctgcagattctagggctgcaaaaaactgaa
tttgatgaggaaacccagagacttctgacagttgcagaagaagaaaatccctccttgaca
gttataggtgactggtga

DBGET integrated database retrieval system