KEGG   Acinonyx jubatus (cheetah): 106980953
Entry
106980953         CDS       T04657                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04010  MAPK signaling pathway
aju04060  Cytokine-cytokine receptor interaction
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04217  Necroptosis
aju04650  Natural killer cell mediated cytotoxicity
aju04668  TNF signaling pathway
aju04932  Non-alcoholic fatty liver disease
aju04940  Type I diabetes mellitus
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05142  Chagas disease
aju05143  African trypanosomiasis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05320  Autoimmune thyroid disease
aju05330  Allograft rejection
aju05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106980953 (FAS)
   04668 TNF signaling pathway
    106980953 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106980953 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106980953 (FAS)
   04217 Necroptosis
    106980953 (FAS)
   04115 p53 signaling pathway
    106980953 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    106980953 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106980953 (FAS)
   05205 Proteoglycans in cancer
    106980953 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106980953 (FAS)
   05330 Allograft rejection
    106980953 (FAS)
   05332 Graft-versus-host disease
    106980953 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106980953 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    106980953 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106980953 (FAS)
   04932 Non-alcoholic fatty liver disease
    106980953 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106980953 (FAS)
   05161 Hepatitis B
    106980953 (FAS)
   05160 Hepatitis C
    106980953 (FAS)
   05164 Influenza A
    106980953 (FAS)
   05162 Measles
    106980953 (FAS)
   05168 Herpes simplex virus 1 infection
    106980953 (FAS)
   05163 Human cytomegalovirus infection
    106980953 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106980953 (FAS)
   05169 Epstein-Barr virus infection
    106980953 (FAS)
   05165 Human papillomavirus infection
    106980953 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    106980953 (FAS)
   05143 African trypanosomiasis
    106980953 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106980953 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aju04050]
    106980953 (FAS)
   04090 CD molecules [BR:aju04090]
    106980953 (FAS)
Cytokine receptors [BR:aju04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   106980953 (FAS)
CD molecules [BR:aju04090]
 Proteins
  106980953 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 Stn1_C
Other DBs
NCBI-GeneID: 106980953
NCBI-ProteinID: XP_026905646
UniProt: A0A6J1YKM8
LinkDB
Position
Unknown
AA seq 314 aa
MKGPWAVRWLILTSVAGSLFRGDSAQVTDVNSKVLKLSKNATEGEPGCKEGLHRGSQFCC
LPCPPGTRKAADCEEDGGRPSCIPCEEGKDYTDGSHFSPRCRRCRICDGEHGLEVEKTCT
RTQNTKCRCKSNFFCNVSLCDHCNPCMMCEHGILENCTPTSNTKCKQGSSSKLLWLCALL
PILLSALVCCCVLKKYRNTKNGRQESTVSITESMPMNFADIDLSKYISSIAEQMKITQVR
EFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGRKGAYYALVKGLRKANLCAL
AEKIEDMVQKDSAS
NT seq 945 nt   +upstreamnt  +downstreamnt
atgaaggggccctgggccgtccgttggctgatacttacctctgttgccggatcactgttc
agaggcgacagtgctcaggtcaccgatgtcaactccaaggtgttgaaattgagtaagaac
gctaccgaaggggagcctggatgcaaggaaggtctgcatcgtgggagccagttctgctgt
ctgccatgccctcctggcacacgaaaagctgccgactgtgaagaagatgggggtagaccg
tcctgtataccctgtgaagaagggaaggactacacagacgggagccatttttctcccaga
tgcagaagatgtagaatttgtgatggagagcatggcttagaagtggaaaaaacctgtacc
cggacccagaataccaagtgcagatgtaaatcaaactttttttgtaacgtctctctgtgt
gaccactgtaacccgtgcatgatgtgtgaacatggaatccttgagaattgcacaccaacc
agcaacaccaaatgtaaacaaggatccagctccaaacttctgtggctttgtgccctgctc
ccgattctactgtccgcactagtatgttgctgtgtgttgaaaaagtacaggaatacaaag
aatggccgccaggaatctacagtctcaattactgagagtatgccgatgaatttcgcagac
atcgacttgagtaaatacatcagtagcattgccgaacaaatgaaaataactcaagtcaga
gaatttgtccgcaagaacggtatcaacgaagccaaaatagatgagatcaagaacgacaac
ctccaagacacagctgaacagaaagtccaactgctccggaattggtaccagctccacggg
aggaagggcgcatattacgctctggtgaaaggtctcaggaaagccaatctctgcgctctt
gccgagaaaattgaagatatggtccagaaggacagtgcgagctaa

DBGET integrated database retrieval system