KEGG   Acinonyx jubatus (cheetah): 106980972Help
Entry
106980972         CDS       T04657                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X3
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00562  Inositol phosphate metabolism
aju01100  Metabolic pathways
aju01521  EGFR tyrosine kinase inhibitor resistance
aju04068  FoxO signaling pathway
aju04070  Phosphatidylinositol signaling system
aju04071  Sphingolipid signaling pathway
aju04115  p53 signaling pathway
aju04140  Autophagy - animal
aju04150  mTOR signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04510  Focal adhesion
aju04931  Insulin resistance
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05206  MicroRNAs in cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05218  Melanoma
aju05222  Small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05230  Central carbon metabolism in cancer
aju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106980972 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106980972 (PTEN)
   04070 Phosphatidylinositol signaling system
    106980972 (PTEN)
   04071 Sphingolipid signaling pathway
    106980972 (PTEN)
   04151 PI3K-Akt signaling pathway
    106980972 (PTEN)
   04150 mTOR signaling pathway
    106980972 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106980972 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    106980972 (PTEN)
   04218 Cellular senescence
    106980972 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106980972 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106980972 (PTEN)
   05206 MicroRNAs in cancer
    106980972 (PTEN)
   05230 Central carbon metabolism in cancer
    106980972 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106980972 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106980972 (PTEN)
   05214 Glioma
    106980972 (PTEN)
   05218 Melanoma
    106980972 (PTEN)
   05215 Prostate cancer
    106980972 (PTEN)
   05213 Endometrial cancer
    106980972 (PTEN)
   05224 Breast cancer
    106980972 (PTEN)
   05222 Small cell lung cancer
    106980972 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    106980972 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106980972 (PTEN)
   05165 Human papillomavirus infection
    106980972 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106980972 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106980972 (PTEN)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106980972 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     106980972 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106980972 (PTEN)
Protein phosphatases and associated proteins [BR:aju01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106980972 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DUF3256
Motif
Other DBs
NCBI-GeneID: 106980972
NCBI-ProteinID: XP_014934557
LinkDB All DBs
Position
Unknown
AA seq 206 aa AA seqDB search
MMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEF
FHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLV
LTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHY
RYSDTTDSDPENEPFDEDQHTQITKV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttgaaactattccaatgttcagtggcggaacttgcaatcctcagtttgtggtc
tgccagctcaaggtgaagatctattcctccaattcgggacccacacgacgggaagacaag
ttcatgtacttcgagttccctcagccgctgcctgtgtgtggtgacatcaaagtagagttc
ttccacaaacagaacaagatgctaaaaaaggacaaaatgtttcacttttgggtaaataca
ttcttcataccaggaccagaggaaacctcagaaaaagtagaaaatggaagtctatgtgat
caagaaattgatagtatttgcagtatagagcgtgcagataatgacaaggaatatctagta
ctcactttaacaaaaaatgatctcgacaaagcaaataaagacaaggccaaccgatacttt
tctccaaattttaaggtgaagctgtacttcacaaaaacagtagaggagccatcaaatcca
gaggctagcagttcaacttctgtaacaccagatgttagtgacaatgaacctgatcattat
agatattctgacaccactgactctgatccagagaatgaaccttttgatgaagatcagcat
acacaaattacaaaagtctga

DBGET integrated database retrieval system