KEGG   Acinonyx jubatus (cheetah): 106981721
Entry
106981721         CDS       T04657                                 

Gene name
RCHY1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1 isoform X1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04115  p53 signaling pathway
aju04120  Ubiquitin mediated proteolysis
aju05162  Measles
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106981721 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106981721 (RCHY1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    106981721 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aju04121]
    106981721 (RCHY1)
Enzymes [BR:aju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106981721 (RCHY1)
Ubiquitin system [BR:aju04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    106981721 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 Prok-RING_4 zf-RING_11
Other DBs
NCBI-GeneID: 106981721
NCBI-ProteinID: XP_014935351
UniProt: A0A6I9ZZR4
LinkDB
Position
Unknown
AA seq 264 aa
MEEMAASAREDGARGQKQGRRGCKHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKV
KEVQCINCEKIQHAQQTCEECSTLFGEYYCSICHLFDKDKKQYHCENCGICRIGPKEDFF
HCLKCNLCLAMNLQGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEML
KEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILG
MKCNICESYNTAQAGGCRISLDQQ
NT seq 795 nt   +upstreamnt  +downstreamnt
atggaggagatggcggcttcggcgcgggaagatggcgcccgcggccaaaagcaagggcgg
cggggctgcaagcactatgacagaggatgtctcctgaaggcaccttgttgtgataaactt
tatacttgtcggttgtgtcatgataacaatgaagatcatcagctagatcgctttaaagta
aaggaagtgcagtgcataaactgtgaaaaaatccaacacgcccaacagacttgtgaagaa
tgtagcacattgtttggagaatattattgcagtatatgccatctttttgacaaagacaag
aagcagtatcattgtgaaaactgtggcatttgtaggattggtccaaaggaagattttttc
cattgtttgaaatgtaacttatgtctagctatgaatctccaaggaaagcacaagtgtatt
gaaaatgtttcccggcagaattgtccaatatgtttggaggacattcacacatcccgtgtt
gttgctcatgtcttgccgtgtggacatcttttacatagaacgtgttatgaagaaatgttg
aaagaaggctacagatgtccattatgtatgcactctgctttagatatgactaggtactgg
agacagctggatgatgaggtagcacagactcctatgccatcagaatatcagaacatgact
gtggatattctctgcaatgattgcaatgggagatctactgtccagttccatatattaggc
atgaaatgtaatatttgtgaatcttacaatactgctcaagctggaggatgtagaatttca
ctagatcagcaatga

DBGET integrated database retrieval system