KEGG   Acinonyx jubatus (cheetah): 106981879Help
Entry
106981879         CDS       T04657                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00052  Galactose metabolism
aju00500  Starch and sucrose metabolism
aju01100  Metabolic pathways
aju04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106981879 (GAA)
   00500 Starch and sucrose metabolism
    106981879 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106981879 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106981879 (GAA)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106981879 (GAA)
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106981879 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 106981879
NCBI-ProteinID: XP_026907940
LinkDB All DBs
Position
Unknown
AA seq 952 aa AA seqDB search
MDARWPLCCRPLLGAYILVSLATTALLGHVLLHDFLLVPQEQRDFSQVAEGLYRAHQQGA
GHPDPQAPPGHHGSPRAAPTRCDVPPNSRFDCAPDKAITQEQCEARGCCYVPAGQWPRVP
RMGQPWCFFPPSYPSYKLHNLTTTETGYTATLTRATPTFFPKDILTLRLDVLLETESRLH
FTIKDPANRRYEVPLETPRVRSRASSTLYSVDLQEEPFGVVVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQHITGLAEHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLV
LEDGGLAHGVFLLNSNAMDVILQPSPALSWRSTGGILDMYIFLGPEPKSVVRQYLEVVGS
PFMPPYWGLGLHLCRWGYTSTAVTRQVVENMTRADFPLDTQWNDLDYMDARRDFTFNKDG
FGDFPAMVQELHRSGRHYVMIVDPAISSSSPPGSYRPYDEGLRRKVFITNDTGQPLIGKV
WPGFTAFPDFTSPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDSDLEN
PPYVPGVVGGTLRAATICASSHQFLSTHYNLHNLYGLTEALASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLAYSVPEILLFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNDLHSLPQEPYRFSETAQRAMRKALALRYRLLPHLYTLFHQAHVGG
ETVARPLFLEFPEDPCTWAVDRQLLWGAALLITPVLEAGKVEVTGYFPAGTWYDLQTVPA
EALGSLPPPPPAPVTPAIHSRGQWVTLPAPLDTINLHLRAGHIIPLQGLGLTTTESRKQP
MALVAALTTNGEARGELFWDDGESLETLERGAYTQVVFLAKNNTVVNELVHVTSEGAGLQ
LRKATVLGVAAAPKQVLSNGVPVSNFTYSPDTKTLDVPVSLTMGEQFVISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaggtggccgctgtgctgccgccccctgctgggggcctacatcctcgtgtcc
ctggccaccaccgccctcctggggcacgtcctgctccatgatttcttgctggtcccccaa
gagcagcgtgacttctcccaagtagctgaggggctttatcgtgctcaccagcagggagcc
ggccacccagacccccaggcccccccaggccaccacggcagtcccagagcagctcccaca
cggtgcgacgtgccccccaacagccgcttcgactgcgccccggacaaggccatcacccag
gagcagtgtgaggcccggggctgctgctacgtgcctgccgggcagtggcctcgggtcccc
cgcatgggacagccctggtgcttctttccacccagctacccgagttacaagctgcacaac
ctgaccaccacggagacaggctacacggccaccctgacccgcgccaccccaaccttcttc
cccaaggacatcttgaccttacgcctggacgtgctgctggagactgagagtcgactccac
ttcacgatcaaagatcccgccaacaggcgctacgaggtgcccttggagaccccgcgtgtc
cgcagccgggcctcatccacactttacagcgtggacctccaggaggagcccttcggggtg
gtcgtgcgccggaagctggacggccgggtgctgctgaacacgacggtggcccccctgttc
tttgctgaccagtttctgcagctgtccacctctctgccgtcccagcacatcacgggcctg
gccgagcatcttggctccctgatgcttagcaccaactggaccaagatcaccctgtggaac
cgggacatcgcccccgagcccaacgtgaacctgtacgggtcccaccccttctacctggtg
ctggaggacggcggcctggctcacggggtcttcctgctgaacagcaatgccatggatgtg
atcctgcagccgagcccggccctcagctggcggtccacgggtgggatcctggacatgtac
atcttcctgggccctgagcccaagagcgtggtgcggcagtacctggaagtcgtgggctcc
ccgttcatgccgccctactggggcctggggctccacctctgccgctggggctacacctcc
acggcggtcacccgccaggtggtggagaacatgaccagggccgacttccccctggacact
cagtggaatgacctggattacatggacgcgaggagagacttcactttcaacaaggacggc
ttcggggacttcccagccatggtgcaggagctccaccggagcggccggcactacgtgatg
atcgtcgaccctgccatcagcagctccagccctcctggcagctaccgaccttatgacgag
ggtctacggaggaaggttttcatcaccaatgacactgggcagccactgattgggaaggtg
tggcccggatttaccgccttccccgacttcaccagccccgaggcccttgactggtggcag
gacatggtggctgagttccacgcccaggtgcctttcgacggcatgtggatcgacatgaac
gagccatccaacttcgtcaagggctctgtggacggctgccccgacagtgacctggagaac
ccgccctacgtgccaggggtggttggcgggaccctgcgggcagccaccatctgtgcctcc
agccaccagttcctctccacgcactacaacctgcacaacctgtacggcctgacagaagcc
cttgcctcccacagggccctggtcaaggctcgggggacgcgccccttcgtgatctcccgc
tcgaccttcgcgggccacggccgatacgccggccactggacaggggacgtgtggagcagc
tgggagcagctggcgtactctgtgccagaaatcctgctcttcaacctgctgggggtgccg
ctggtcggggccgatgtgtgcggcttcctgggcaacacgtcggaggagctgtgtgtccgc
tggacccagctgggggccttctaccccttcatgcggaaccacaacgacctccacagcctg
cctcaggagccgtacaggttcagcgagacggcgcagcgagccatgaggaaggccctcgcc
ctgcgctacaggctgctgccccacctgtacacgctgttccaccaggcccacgttgggggc
gagaccgtggcccggcccctcttcctggagttccccgaggacccctgcacctgggccgtg
gaccgccagctcctgtggggagcagctctgctcatcaccccggtgctcgaggccgggaag
gttgaagtgactggttacttccccgctggtacatggtacgacctgcagacggtgccagca
gaggccctcggcagcctcccgcctccacctcccgcacctgtcacgcctgccatccacagc
aggggacagtgggtgacactgccagccccactggacaccatcaacctccacctccgggcc
gggcacatcatccccctgcagggccttggcctcacaaccacggagtcccgaaagcagccc
atggccctggtcgcagccctgaccacgaacggggaggcccgaggagagctgttctgggac
gacggggagagcctggagacgctcgagcgtggggcctacacgcaggtcgtcttccttgcc
aagaataacaccgttgtgaacgagctggtgcacgtgaccagcgagggggccggcctgcaa
ctgaggaaggccaccgtcctgggggtggccgcggcccccaagcaggtcctctccaatggc
gttcctgtctccaacttcacctacagccctgacacgaagaccctggacgtccctgtctca
ctgacgatgggagaacagtttgtcatcagctggtcttaa

DBGET integrated database retrieval system