KEGG   Acinonyx jubatus (cheetah): 106981916
Entry
106981916         CDS       T04657                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5 isoform X1
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04390  Hippo signaling pathway
aju05161  Hepatitis B
aju05200  Pathways in cancer
aju05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    106981916 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106981916 (BIRC5)
   04215 Apoptosis - multiple species
    106981916 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106981916 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106981916 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    106981916 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106981916 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aju01002]
    106981916 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106981916 (BIRC5)
Peptidases and inhibitors [BR:aju01002]
 Peptidase inhibitors
  Family I32: IAP family
   106981916 (BIRC5)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     106981916 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106981916 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 106981916
NCBI-ProteinID: XP_026908362
UniProt: A0A6J1YT49
LinkDB
Position
Unknown
AA seq 142 aa
MGASSLPPAWQLYLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNHK
QKEFEETAKRVRCAIEQLVALE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggcgcttcgtcgttgcccccggcctggcagctctacctcaaggaccaccgcatctct
acgttcaagaactggccgttcttggagggctgcgcctgcactccggagcggatggccgag
gccggcttcatccactgtcccactgagaacgagcccgatttggctcagtgtttcttctgc
ttcaaggagctggaaggctgggagccagacgatgaccccatagaggaacataagaagcat
tcatctggttgtgcctttctttctgtcaagaagcagtttgaagaattaaccctcagtgaa
tttttgaaactggacaaagagagagccaagaacaaaattgcaaaggaaaccaaccataaa
cagaaagaatttgaagagactgcaaagagggtgcgctgtgccattgagcagctggtggcc
ctggagtga

DBGET integrated database retrieval system