KEGG   Acinonyx jubatus (cheetah): 106981939
Entry
106981939         CDS       T04657                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106981939 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aju04030]
    106981939 (PTGDR)
G protein-coupled receptors [BR:aju04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    106981939 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 PhoR
Other DBs
NCBI-GeneID: 106981939
NCBI-ProteinID: XP_014935572
LinkDB
Position
Unknown
AA seq 358 aa
MRQPLYRCYNITSVEKGYSATMGGVLFSAGLLGNLLALGLLARSGLGSCPRRTPPSVFYV
LVCGLTVTDLLGKCLVSPFVLAAYAQNRSLWGLAPASDSSLCQTFAFFMSFFGLASTLQL
LAMALECWLSLGHPFFYRRHITLRRGALVAPVVGAFCLAFCALPFAGIGKFVQYCPGTWC
FIQMVHEERSPSVLRYSVLYASLMALLVLAIVLCNLSAMRNLYEMHRRLRRRPRSGTRDR
AEPGAGEKEAAVKPLEELDHLLLLALMTVLFTLCSLPLIYRAYYGAFKAVNEENGTFEEM
EDLQALRFLSVISIVDPWIFIIFRTPVFRMSFHKIFIRPLMYRNWYSNSCRTNMESSL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcggcagccgctctaccgctgctacaacatcacctccgtggagaagggctactcggcg
accatgggcggggtgcttttcagcgcgggcctcctgggcaacctgctggcgctggggctg
ctggctcgctcggggctggggtcttgcccgcggcgcacgccgccctcggtcttctacgtg
ctggtgtgcggcctgacggtcacagacttgctgggcaaatgcctcgtgagccccttcgtg
ctggccgcctacgcgcagaaccggagcctgtggggactggcgcccgcgtcggacagctcg
ctgtgccaaacgttcgcctttttcatgtctttctttgggctcgcctccacgctgcagctc
ctggccatggccctggagtgctggctctccctggggcaccccttcttctaccgacggcac
atcaccctgcgccgcggcgcgctggtggcgcccgtcgtgggcgccttctgcctggctttc
tgcgcgctgcccttcgcgggcatcgggaagttcgtgcagtactgccccggcacctggtgc
ttcatccagatggtgcacgaggagcgctcgccgtcggtgctgcgctactcagtgctctac
gccagccttatggccctgctggtcctcgccatcgtgctgtgcaacctgagcgccatgcgc
aacctctacgagatgcaccggcggctgcggcggcgcccgcgctccggcaccagggaccgc
gcggagccgggcgcgggcgagaaggaggcggctgtgaagcccctggaggaactggaccac
ctgctgttgctggccctcatgacggtgctcttcactctgtgctccctgccgttaatatat
cgtgcttactatggagcatttaaagcggtcaatgaggaaaatggcacctttgaagaaatg
gaagacctccaagccttgcgttttctatctgtaatctccattgtggacccttggattttc
ataattttcagaacaccggtatttcggatgtcttttcacaagattttcataaggcctctt
atgtacagaaattggtatagcaattcctgccgaactaacatggagtccagtctgtga

DBGET integrated database retrieval system