KEGG   Acinonyx jubatus (cheetah): 106982096Help
Entry
106982096         CDS       T04657                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00010  Glycolysis / Gluconeogenesis
aju00053  Ascorbate and aldarate metabolism
aju00071  Fatty acid degradation
aju00280  Valine, leucine and isoleucine degradation
aju00310  Lysine degradation
aju00330  Arginine and proline metabolism
aju00340  Histidine metabolism
aju00380  Tryptophan metabolism
aju00410  beta-Alanine metabolism
aju00561  Glycerolipid metabolism
aju00620  Pyruvate metabolism
aju01100  Metabolic pathways
Module
aju_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106982096 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    106982096 (ALDH2)
   00620 Pyruvate metabolism
    106982096 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106982096 (ALDH2)
   00561 Glycerolipid metabolism
    106982096 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106982096 (ALDH2)
   00310 Lysine degradation
    106982096 (ALDH2)
   00330 Arginine and proline metabolism
    106982096 (ALDH2)
   00340 Histidine metabolism
    106982096 (ALDH2)
   00380 Tryptophan metabolism
    106982096 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106982096 (ALDH2)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106982096 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 106982096
NCBI-ProteinID: XP_026899631
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MFRAAASLGPRLGRRLLSAAATQAVPAPNQQPEVLFNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARDAFQWGSPWRRMDASDRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIIPG
FGPTAGAAIASHQDVDKVAFTGSTEVGHLIQIAAGSSNLKRVTLELGGKSPNIIMSDADM
NWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKSRVVGNPFDSQTEQGP
QVDKTQFQKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcgccgctgccagtctcgggccccgcctgggccgccgcctcctgtcggccgcc
gccacccaggcggtaccggcccccaaccagcagcctgaagtcctcttcaaccagatcttc
ataaacaatgagtggcacgatgctgtcagcaggaaaacattccccaccgtcaatccatcc
actggagaagtcatctgtcaggtagctgaaggagacaaggaagatgtagacaaggcagta
aaggctgcccgggacgccttccagtggggctcaccctggcgccgcatggacgcatccgat
aggggccgcctgctgaaccgcctggctgatctgattgagcgggaccggacctacctggca
gccttggagacgctggataacggcaagccctacgtcatctcctacctggtggatttggac
atggtccttaaatgcctccgttattatgctggctgggctgataagtaccatgggaaaacc
attcccatcgatggggacttcttcagttatacccgccatgaacctgtcggggtgtgcggg
cagatcattccgtggaacttcccgctcctgatgcaagcctggaaactgggcccagccctg
gcgaccggaaacgtggttgtgatgaaggtggctgagcagactccactcaccgccctctac
gtggccaacctcattaaggaggctggctttccccctggtgtggtcaatattatccctgga
tttggtcccacagctggggctgccatcgcctcccatcaggatgtggacaaagtagccttc
acgggctccactgaggttggccacctgatccagattgctgcagggagcagtaacctcaag
agagtgaccctggagctggggggaaagagccccaatatcattatgtcggatgcagacatg
aactgggccgtggagcaggcccactttgccctgttcttcaaccagggccagtgctgctgt
gcgggctcccggacctttgtgcaagaagatgtttatgctgagtttgtggagcggagtgtc
gcccgggccaagtctcgtgtagttgggaacccctttgacagccagacggagcaggggcca
caggtggacaaaactcagtttcagaaggtcctcggttatatcaaatctgggaaggaggag
ggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggctacttcatccagccc
actgtgttcggagatgtgcaagacggcatgaccatcgccaaggaggagatctttgggcca
gtgatgcagatcctgaagttcaagaccatagaggaggtcattgggagagccaacaattcc
aagtatgggctggctgcagctgtcttcaccaaggacttggacaaggccaattatctgtcc
caagccctccaggctggcactgtgtgggtcaactgctatgatgtgtttggggcccagtca
ccgttcggaggctacaagatgtccgggaatggccgggagctaggagagtatgggctgcag
gcatacactgaagtgaaaacggtcacgatcaaagtgcctcagaagaactcctga

DBGET integrated database retrieval system