KEGG   Acinonyx jubatus (cheetah): 106982200Help
Entry
106982200         CDS       T04657                                 

Gene name
PARK7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju05012  Parkinson's disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    106982200 (PARK7)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     106982200 (PARK7)
Peptidases [BR:aju01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   106982200 (PARK7)
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106982200 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 106982200
NCBI-ProteinID: XP_014935847
LinkDB All DBs
Position
Un
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVLICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQEKRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALAIVEALSGKDVADQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaagagctctggtcatcctggccaaaggagcagaggagatggagacagtc
attcctgtagatgtcatgaggcgagccggaattaaagtcaccattgcgggtctggctggg
aaagacccggtacagtgtagccgagatgttctcatttgtccggatgccagtctggaagat
gcaaaaaaagagggaccttacgatgtagtggttctgccgggaggtaacctgggtgcacag
aatttatctgagtctgctgctgtgaaagagatactgaaggaacaagaaaaaaggaagggc
cttattgccgctatctgtgcaggtcctacggctctcttggctcatgaaataggttttgga
agcaaagttacgacacacccgcttgctaaagacaaaatgatgaatgggagtcattacagc
tactccgagaaccgcgtggagaaggacggcctgatcctcacgagccgcgggcctggaacc
agcttcgagtttgctcttgcgattgttgaagcgctgagtgggaaggacgtggctgaccaa
gtgaaggccccgctcgtgcttaaggattag

DBGET integrated database retrieval system