KEGG   Acinonyx jubatus (cheetah): 106982428Help
Entry
106982428         CDS       T04657                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04110  Cell cycle
aju04213  Longevity regulating pathway - multiple species
aju04330  Notch signaling pathway
aju04919  Thyroid hormone signaling pathway
aju05016  Huntington's disease
aju05034  Alcoholism
aju05165  Human papillomavirus infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05203  Viral carcinogenesis
aju05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aju00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    106982428 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    106982428 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    106982428 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    106982428 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    106982428 (HDAC1)
   05202 Transcriptional misregulation in cancers
    106982428 (HDAC1)
   05203 Viral carcinogenesis
    106982428 (HDAC1)
   05220 Chronic myeloid leukemia
    106982428 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    106982428 (HDAC1)
  Substance dependence
   05034 Alcoholism
    106982428 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    106982428 (HDAC1)
   05165 Human papillomavirus infection
    106982428 (HDAC1)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106982428 (HDAC1)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     106982428 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     106982428 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106982428 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    106982428 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 106982428
NCBI-ProteinID: XP_014936102
LinkDB All DBs
Position
Un
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctatcgaaaaatggaaatatatcgccctcacaaggccaat
gctgaggagatgaccaagtaccacagtgacgactacattaaattcttgcgctccatccgc
ccagataacatgtctgagtacagcaaacagatgcagagattcaacgttggtgaggactgt
ccggtatttgatggcctgtttgagttctgtcagttatctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacagacatcgctgtgaattgggctgggggcctgcat
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccgggaactggggacctacgggatattggggctggcaaaggcaag
tattacgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccaacccagtgcagttgtcttacag
tgtggctctgactccctatctggggatcggttaggttgcttcaacctgaccatcaaaggg
cacgccaagtgtgtagagtttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggtggttataccatccgtaatgtggcccgctgctggacgtatgaaacagccgtggctctg
gacacggagatcccaaatgagcttccatacaacgactacttcgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaacaccaatgagtacctggag
aagatcaaacagcgactgtttgagaacctgcgaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaggatgccattccagaggagagtggcgacgaggacgaagaagat
cctgacaagcgcatctcgatctgttcctctgacaaacgaatcgcctgtgaggaagagttc
tcggactctgatgaagagggtgaaggcggtcgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaactgaggatgaaaaagagaaagatccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system