KEGG   Acinonyx jubatus (cheetah): 106983500
Entry
106983500         CDS       T04657                                 

Gene name
ATF6B
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04022  cGMP-PKG signaling pathway
aju04141  Protein processing in endoplasmic reticulum
aju04151  PI3K-Akt signaling pathway
aju04211  Longevity regulating pathway
aju04261  Adrenergic signaling in cardiomyocytes
aju04668  TNF signaling pathway
aju04728  Dopaminergic synapse
aju04911  Insulin secretion
aju04915  Estrogen signaling pathway
aju04918  Thyroid hormone synthesis
aju04925  Aldosterone synthesis and secretion
aju04926  Relaxin signaling pathway
aju04927  Cortisol synthesis and secretion
aju04928  Parathyroid hormone synthesis, secretion and action
aju04934  Cushing syndrome
aju04935  Growth hormone synthesis, secretion and action
aju05020  Prion disease
aju05030  Cocaine addiction
aju05031  Amphetamine addiction
aju05034  Alcoholism
aju05161  Hepatitis B
aju05163  Human cytomegalovirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106983500 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    106983500 (ATF6B)
   04022 cGMP-PKG signaling pathway
    106983500 (ATF6B)
   04151 PI3K-Akt signaling pathway
    106983500 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    106983500 (ATF6B)
   04915 Estrogen signaling pathway
    106983500 (ATF6B)
   04926 Relaxin signaling pathway
    106983500 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    106983500 (ATF6B)
   04918 Thyroid hormone synthesis
    106983500 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    106983500 (ATF6B)
   04925 Aldosterone synthesis and secretion
    106983500 (ATF6B)
   04927 Cortisol synthesis and secretion
    106983500 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106983500 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    106983500 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    106983500 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106983500 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    106983500 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    106983500 (ATF6B)
   05031 Amphetamine addiction
    106983500 (ATF6B)
   05034 Alcoholism
    106983500 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106983500 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106983500 (ATF6B)
   05161 Hepatitis B
    106983500 (ATF6B)
   05163 Human cytomegalovirus infection
    106983500 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106983500 (ATF6B)
Transcription factors [BR:aju03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106983500 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 106983500
NCBI-ProteinID: XP_014937189
UniProt: A0A6J0A4W8
LinkDB
Position
Unknown
AA seq 712 aa
MAGGREGKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SQVPAVGEVLVVKTESLAPPLCLLGDDPTSPFEMVQINVGPTSDDPSDVQTKLEPVSPSS
SINSEASLLSAESPNQGFIGEEVLEVKTESPSPQGCLLRDVLAPPLGGVQISMGPSSDGS
LGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISDPPPAPISPRMSGEEPRPRRHLLEFSAQEPVHGVEPLQGSSLGPEEPQPSPPGRP
SFRNLTAFPGGSAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIP
QRAQEKQKSQLWKKSPPVKAVPTQPPGPPERDSAGQLQLYRHPDRSQPEFLDAIDRREDT
FYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMD
TRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAGQARQASHQPLYLNHP
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggctggggggcgggagggaaagatggcggaactgatgctgctcagcgagattgcggac
ccgacacgttttttcaccgataacttgctgagcccggaggactggggtctgcggaacagc
accttgtatactggcttagatgatgtcgcggaggagcagacgcagctcttccgttgccca
gagcaggatgtcccgtttggcagtagttccttggacgtggggatggatgtcagccctcct
gagccaccctgggacccattgcctatctttccagatcttcaggtgaagtctgagccgtcc
tccccctgctcctcttcctccctcagctctgaatcatcgcgtctttccacagagccctct
agccaggtccctgctgtgggggaggtgctggttgtgaagacagagtccttggcaccccca
ctctgcctcctaggagatgatccaacatccccatttgaaatggtccagatcaatgtgggt
cccacctctgatgacccctcagatgtccagaccaagctagagcctgtctctccatcttcc
tccatcaactctgaggcttccctgctctcagcagagtcccccaaccagggttttatagga
gaggaggtactggaagtgaagacagagtcaccatcccctcaagggtgtctcctgcgggat
gtcctagcccccccacttggaggtgtccagatcagcatgggcccatcctctgatggctcc
ttaggcaaagccctgcccacccggaagccaccgctgcagcccaaacctgtggtgataacc
actgtcccaatgccacccagagctgtgcctcctagcaccaccatccttttgcagcctctt
gtccaaccacccccagtgtcaccagttgtcctcatccaaggtgctattcgggtccagcct
gaggggccggccccccctgctccaaggcctgagaggaagagcattgttccagctcctatg
cctgggaactcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcggcctgccagtccaggaggaagaagaaggagtatctgcagggg
ctggaggctcggctgcaggcggtgctggcggacaaccagcagctccgcagggagaatgct
gccctccggcggcggctggaggccctgctggccgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtgttccttcttttcattgccttcaactttgga
cctgtcagcatcagtgaccctcctccagctcccatctctcctcggatgagtggagaggag
cctcgaccccggagacacttgctggagttctcagcgcaagagccggttcatggagttgaa
cccctccagggttcctccctgggccctgaggagccccagcccagccccccaggccggcca
agtttcaggaacctgacagccttcccggggggcagtgccaaggagctgctgctgagagac
ctggaccagctcttcctctcctctgattgccggcacttcaaccgaaccgagtccctgagg
cttgcggacgagctgagcggctgggtccagcgtcaccagagaggccggcggaagatcccc
cagagggcccaggagaaacagaagtctcagctctggaagaagtcgcctccagttaaggca
gttcccacccaaccccctgggcccccagaaagggattctgcgggccaactgcagctatat
cgccacccagaccgttcgcagccagagttcctggatgcaattgaccgacgagaagacaca
ttttacgttgtgtccttccgaagggaccacttgctgctccctgccatcagccacaacaag
acctctcggcccaagatgtccctggtgatgcctgccatggcccccaatgagaccctgtca
ggccggggggctccaggagactatgaggagatgatgcagatcgagtgtgaggtcatggac
acccgggtgattcacatcaagacctccacggtgcctccctcgctccgaaaacagccatcc
tcgaccccaggcaatgccacaggtggccccttgccagcttctgcagccggccaggcacgc
caggcctcccaccagcccctctacctcaatcacccctga

DBGET integrated database retrieval system