KEGG   Acinonyx jubatus (cheetah): 106983760Help
Entry
106983760         CDS       T04657                                 

Gene name
FAN1
Definition
(RefSeq) fanconi-associated nuclease 1 isoform X1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    106983760 (FAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aju03400]
    106983760 (FAN1)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     106983760 (FAN1)
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     106983760 (FAN1)
DNA repair and recombination proteins [BR:aju03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     106983760 (FAN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC RPN6_N DUF4363 zf-TRAF
Motif
Other DBs
NCBI-GeneID: 106983760
NCBI-ProteinID: XP_014937434
LinkDB All DBs
Position
Unknown
AA seq 1027 aa AA seqDB search
MMSEGKAPAKKRPRRSLSASKTKTKECNSIISFFNNAPPAKLACPVCSKMVQRYDLNRHL
DEKCANNDDITPVDQRHVDLTNSHVPTVDLTNIVLEDVMPGKLSPSKISLTPDQSDSANM
GIKQQTSPYFKNNDDLGCKNQDKLRHHNVKVITLGSLSSKLSRRYTEAKRAIDKNEEFAN
KSPQSSSSTVVRTLVDNCSETEDKDQILENSSQKENVFACDSLKERSTPEHTVEGTKIME
AESQTATQEYERSPLGPAFSDNAAMLFSPDLTLGNTLKSTSEHSLAKWESIKGVDNQDVE
KCEAGSCEEVKVTVASETKIQLSNWEAKSDSSTHDDSKGHNIQYLSPEGDSDLKNEITCG
IPLEQGSSCDVPGKTITVPPSHPYYLRSFLVVLRAVFENEEDRMLFDEHERGIVTKFYQL
SASGQKLYVRLFQRKFGWIKMNKLEYEEIAPDLTPVIGELQQAGFLQTESELQELSEVLE
LLSAPELKTLAKTFHLVNPNGQKQQLVDTFLKLAKQPSVCTWGKNQSGIGAVILKRAKDL
AGESLRVCKGPRAVFSRVLLLFSLTDSMEDEEAACGGQGQLSTVLLVNLGRMEFPRYTIN
RKTQIFQDRDDLIRYAAAAHMLSDISTAMANGNWKEAKELSQCAKSDWNKLKNHPSLRYH
ENLPLFLRCFTVGWIYTRILSRTVEILQRLHLYEEAVKELENLLSQKVYCPDSRGRWWDR
LALNLHQHLKRLEPAIKCIAEGLADPEVRTGHRLSLYQRAVRLRESPSCQKYRHLFHRLP
EITVEDVKHVTITGRLCPQRGMGKSVFVMEAGGPTAPATVLCSVEEVALAYYRRSGFDQG
IHGEGSTFSTLYGLLLWDVIFMDGIPDVFRNAYQACPLDLCTDSFFTSRGPAIEARLQLI
HSAPAESLRAWVSAAWQAQEGRVASIVSWDRFASLQQAQDLVSCLGGPVLSGVCRRLAVD
FRHCRGGLPDLVVWDSQSHRFKLVEVKGPNDRLSHKQMVWLHELQKLGAEVEVCHVVAVG
AKSKGLN
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagaagggaaagctcctgcgaagaaaagacctcgtagaagtttatcagccagt
aaaactaaaacaaaagaatgtaactctattatttcattttttaacaatgcaccacctgct
aagcttgcctgccctgtttgtagtaaaatggtgcagagatatgacttaaaccggcatctt
gatgaaaagtgtgctaacaatgatgacatcactccagttgatcagaggcatgttgactta
acaaattcacatgtgcctacagtagatttaaccaatattgtcttagaagatgtaatgcca
ggaaagttgtcaccatcaaagataagtttaacccctgaccaaagtgattcagcaaacatg
ggcataaaacagcagaccagcccctactttaaaaataatgatgatttggggtgcaaaaat
caagataagctgagacatcataatgtgaaagtcattactttgggaagcctgtcatctaaa
ttgtccagaagatacacagaggctaaaagagcaatagataagaatgaggaatttgccaat
aagagtccacagagttcctcatccacagtggttaggaccctggttgataactgttcagag
actgaggacaaggatcaaattttggagaacagttctcaaaaggaaaatgtgtttgcctgt
gattctcttaaggagcggagtacacctgaacatactgtagaaggcacaaaaataatggaa
gctgaaagccaaacggctacccaggaatatgagagatcaccccttggccctgccttctca
gataatgctgctatgttattttcaccagatttaactcttgggaatacattgaagtctact
tcagagcacagtcttgcaaagtgggagagcatcaaaggagtagataatcaagatgttgaa
aaatgtgaggcaggtagttgtgaagaagtgaaagtgactgttgcttcagaaactaaaata
cagttgtcaaattgggaggcaaagtctgacagttctacacatgatgattctaaagggcat
aacatccagtacctttctccggaaggtgacagtgacttaaagaatgaaatcacttgcgga
attcctttggagcaggggtcaagctgtgatgttcctggtaaaacaattacagtaccacca
agtcatccttactaccttcggagtttcctcgtggtgctgagagctgtatttgagaatgaa
gaagataggatgctctttgatgaacatgagaggggaattgtaactaaattttatcaatta
tcagctagtggtcagaagttatatgtaagactttttcaacgtaaatttggctggattaag
atgaataaattggaatatgaagagattgctcctgacttaacacctgtgattggagaactg
cagcaagcaggctttctgcagacagagtctgagttgcaagaactctctgaagtgcttgaa
ctgctttctgctcctgaactaaaaaccctggccaagaccttccacttagtgaatcccaat
ggacagaaacagcaactcgtggacacctttctcaaattggccaaacagccttcagtctgc
acttggggaaaaaatcagtctggaatcggtgccgtgattttaaaaagagctaaagatttg
gcaggagagtcactgagagtctgtaaaggccctcgggctgtgttttcccgggtcttgctg
ctattttcattgacggactccatggaagacgaggaagctgcctgtggtggtcagggacag
ctttctactgtgcttttggtcaatcttggccgaatggagtttcctaggtacaccatcaat
cggaaaacccaaatcttccaagatagagatgatctcatcagatacgcagcggccgcgcac
atgctgagtgacatttctactgcaatggccaatgggaactggaaagaagctaaagagctc
tctcaatgtgcaaaaagtgattggaacaaactgaaaaaccacccttccctgagataccat
gagaatttaccactctttctgcgctgctttactgtcgggtggatttacacaaggattctg
tcccgtactgttgaaatattgcagcgacttcacttgtatgaggaagcagtcaaggaactt
gaaaacctcttgtcacagaaagtgtattgtcctgacagcagaggccggtggtgggataga
ttggctctcaacttacaccagcacttgaaacgccttgaaccggctattaagtgcatcgca
gaagggctggcagatccagaagtaagaacaggacatcgtctttcactgtatcagagagcc
gtgcgcctgagagagtctccgagctgtcagaagtacaggcacctcttccatcggctacca
gaaataactgtggaagatgttaaacatgtgaccatcacgggccggctgtgcccgcagcgt
gggatgggcaagtctgtgttcgtgatggaggctggggggcccaccgcccctgccacagtc
ctgtgctctgtggaggaggtggcattggcctattatagacgcagcggcttcgaccagggg
attcacggggaagggtccacctttagcacgttgtatggcctcctcctgtgggatgtaatc
ttcatggacgggataccagacgtcttcagaaatgcctaccaggcatgcccactggacttg
tgtacagacagcttcttcacgagcagggggccggccattgaggccaggcttcagctgatt
cacagcgcccccgcagagagcctgcgggcctgggtgtcagcggcgtggcaggcccaggaa
ggccgagtggcttccattgtcagctgggatcgctttgcttctcttcagcaagctcaggat
cttgtttcctgcttgggcggccctgtcctcagtggtgtgtgcaggcggctggctgtggac
ttccggcactgccgagggggcctccccgacctggtggtgtgggactcccagagtcatcgc
tttaagctggtggaagttaaaggccccaacgatcgtctttcacataagcaaatggtctgg
ttgcacgaactgcagaagttgggggccgaagtagaagtctgccacgtggttgcagttgga
gctaagagcaaaggcctgaactaa

DBGET integrated database retrieval system